KEGG   Thermotoga lettingae: Tlet_0180Help
Entry
Tlet_0180         CDS       T00618                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tle  Thermotoga lettingae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tlet_0180
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_0180
  Lipid metabolism
   00071 Fatty acid degradation
    Tlet_0180
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tlet_0180
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tlet_0180
   00626 Naphthalene degradation
    Tlet_0180
Enzymes [BR:tle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tlet_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(180652..181809)
Genome map
AA seq 385 aa AA seqDB search
MFNIFLPTKIIFGQGSVEHLPDSIKNLGNKAMIVTGKKSTKQSGLLDRIVSLLKKTDVES
VIYDKIQPNPVSNDVDEAAEIAKKENVKFVIGLGGGSAIDSAKAIALTAAMGGKFWDYVE
VGGGKKPDKALPVIAIPTTHGTGTEADPFAVITNPETNEKVGIGYSVIFPKISIVDPEIM
ITLPKNQTAYTSLDAFYHSLEAFLNIDANPYSDILAIDSMKRIVANLPIAYRNGADIYAR
TNLAWASTEAGITETLTGVIANHAIEHGLSGFHPELPHGLGLCITGPYLLEYIFDEIRER
LAILAHEVFNIDEYNTTTAARIFIDMLFEFQELFSLNQKLSSLGFKEKELENIAKVAYRA
MKGVVVKTPKKLQENDLLQIIKKAF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatatttttttgccaacaaagatcatttttggtcagggatctgtcgagcatctc
ccagactcaatcaaaaatctcggaaataaggcaatgatagttacaggaaaaaaaagcacg
aagcaaagcggtttacttgatagaattgtatccttattgaaaaaaacagatgttgagtct
gttatttacgacaaaatccagccaaatccagtaagtaatgatgttgacgaagctgctgag
attgcaaaaaaagaaaatgtcaagtttgtaataggcctgggtggcggaagtgctattgat
tcagcaaaagctattgcattaacagctgcgatgggtggaaaattttgggattatgtcgaa
gtaggtggtggcaaaaagccggacaaagcattacctgtaattgcaataccaacaactcat
ggaacaggaactgaggctgacccattcgcagttatcacaaatccagaaaccaacgaaaaa
gtaggtattggctatagcgttatatttccaaaaatctccattgtggatcccgaaattatg
ataacacttccgaaaaatcagacagcgtacacttccctggacgccttttatcattccctt
gaagcatttctaaatattgacgccaatccttattcagatatcctggccattgattcaatg
aaaagaattgtggcaaacctgcccattgcttatagaaatggtgcagatatctatgcaaga
acaaatcttgcatgggcaagcaccgaagcgggaatcaccgaaacgcttacaggtgtaatc
gcaaatcatgcaatagagcatgggttaagtggctttcatccagaacttcctcatggttta
ggactatgtataacgggcccttatttacttgagtatatctttgacgaaattcgcgaaagg
cttgccatactcgctcatgaagttttcaatattgatgaatacaatacgacaactgctgcc
agaattttcatagatatgctcttcgaattccaagagcttttcagcctgaatcagaaactt
tcatctcttggtttcaaagaaaaagagctcgaaaatatagcaaaagtagcttacagggca
atgaaaggtgttgtggtgaaaactccaaagaaattacaggaaaacgatcttcttcagata
ataaaaaaggcattttga

DBGET integrated database retrieval system