KEGG   Thermotoga lettingae: Tlet_0187Help
Entry
Tlet_0187         CDS       T00618                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tle  Thermotoga lettingae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tlet_0187
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tlet_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
187332..188276
Genome map
AA seq 314 aa AA seqDB search
MNVNRVSVLGSFVVDLAVFSSHIPNPGETVFSESFKMGPGGKGFNQAVAAKRSGADVLFI
TKIGQDLFSILAEQAFEKYDLCKKYLLKSKTYGTGVALIIVNETNGNNAISVVPNACVDI
TLEDVEKNSEIFEKCDVFVAQFESNLQATYRAIELAKRSGAVTVLNPAPVREFDYEILKY
VDILIPNEIEACLLAESFSNCNKVSKIAAKLEKFVDTVIITLGEKGVFCSKISHEIIPAI
RVNTVDTTGAGDAFVGIFASYLSRNYSLRECVNFAITGAALSTTRYGTSPSMPSQKEIEL
MYRSVFSNEEGQDL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtgaatcgcgtgagtgttttgggaagttttgttgtagatctggcagttttttcg
tctcatattccaaatcctggagaaactgttttttcagaatcttttaaaatgggaccaggt
gggaaaggttttaatcaagctgttgctgcaaaacgatctggagcagatgttctgttcatt
accaaaataggccaggatttgttttccattttagctgagcaggcttttgaaaaatacgat
ctttgtaagaaatatttattaaaatcaaaaacttatggaacaggtgttgcactgataatt
gtaaatgaaaccaacggaaacaatgcaatatcagttgtaccgaatgcctgtgttgatata
acgttggaagatgtggaaaaaaattctgaaatatttgaaaaatgtgatgttttcgtagct
caatttgaatctaatttgcaggcaacttacagagctattgaacttgctaaaagatctgga
gctgttactgtgcttaatccggcgcctgttcgagaatttgactatgagatactgaaatat
gtggatatattaattccgaatgaaatagaagcgtgtttgcttgctgaaagtttctcaaat
tgtaataaagtatcgaaaattgctgcaaagctcgaaaaatttgttgatactgttattata
actcttggcgaaaaaggcgtattctgttcaaaaatctctcatgagattattccagccatt
agagttaatactgttgacactacaggggcaggagatgcttttgtaggtatttttgcatcg
tatctttcgagaaactattctctgagagaatgtgtgaatttcgccattactggcgctgct
ctatctacaacaagatatggaacatctccttccatgccctcgcaaaaagagattgaactg
atgtacagatcagttttctctaatgaggagggacaagacctatga

DBGET integrated database retrieval system