KEGG   Thermotoga lettingae: Tlet_0218Help
Entry
Tlet_0218         CDS       T00618                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tle  Thermotoga lettingae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tlet_0218
Enzymes [BR:tle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Tlet_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(join(226680..228095,228095..228835))
Genome map
AA seq 718 aa AA seqDB search
MKDFFPVSVWYGPNKSRAPMTAKVKGLSEIKSEISRIKKIGFNTIRFWYDWATAEPEPDV
WDFSSIEELLNITDELKIKAILQIYTDSAPNWVERDYPDSLFIDRSGLTIHSQSAPGYCS
DHPQVRKHITSFLQNLAKVVSRHDSFLAWDIWSEPHIVQWSWIDYIKDPWFCYCEYSKNR
FIEWLKTKYETVQKLNEIWYRKHGSWEEITIPRYVSLSSFRDLLDWIQFNIEKISEDLFW
KTSAIKKIDPSHPVSSHAAISSVYGIPGIGYGSSDDWKLSEKVDIWGTSFYPKHTGAWMP
LKPHHMGVALDASRSSCESKNKPFWIGELQSGHGVTGLRFSVPVDEFDVERWSWLAISHD
AKGLNYYAWLPMSCGYEVSGFGLANYDGSINNKVIRAGKVSEIISKNMNLFLKAKALQAK
VGILYNIETHKTLACLRAESAEIIREDIFGMYKAMMQMGVNVDFLHISDLLREDLKQYHL
IMIPFSIVIDQKSADAIEKYVRSGGVVLADGRLGWMKEDGTLQEKIPGSGLEKVFGCEEL
YTREIQEQAIDYEDCKLSAYRYLTVYRKTTGIPKAFFNGQPVIVENKYHSGLAIMVGMLI
GLAYEKTENRNNLEFLKQIAQRAGINPDYSTSITSGQEDYLEVRISRSEEKTIVFLFNHG
DEAIEFDLLIPSNNLPALVNNVKCINADQKFEYQACSKALSIKNIFIQGNHTVVLLIE
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagatttcttcccagtatctgtctggtacgggccaaacaaatccagggctcccatg
actgcaaaagttaaaggattatcagagataaaatcagagatttctcgaatcaaaaagatc
ggatttaatactatcagattctggtatgattgggctactgctgaaccggagcctgatgta
tgggatttttcatcaatagaagaattacttaacataactgatgagctgaaaatcaaggct
atacttcaaatttacacagactcagcaccaaactgggtggaaagagattatccagattca
ctctttattgacagatccggtctgactatacattctcaatctgctcctggatactgttca
gaccatccgcaggtaagaaaacatattacaagctttctgcagaatcttgcaaaagtagta
tcaaggcacgattcatttttagcatgggacatatggtctgaaccacatattgttcaatgg
tcatggatagactacatcaaagatccttggttttgttactgcgaatattcaaaaaataga
tttatcgaatggctcaaaactaagtatgaaactgttcaaaaactgaacgaaatctggtat
agaaaacatggaagctgggaagaaatcaccatacctcgatatgtctctttatcaagtttt
agggatcttcttgattggattcaattcaacatcgaaaagatatccgaagatctcttctgg
aaaacctcagcgataaaaaaaatagatccatcacatcctgtatcaagtcatgcagcgatc
tcaagtgtttatggaatacctggtatcggatatggttcatcagacgactggaaactatct
gaaaaagtagatatatggggaacttctttctatccgaagcacacaggcgcatggatgccg
ttaaaaccgcaccacatgggtgttgcacttgatgcaagcagatcttcctgcgaaagtaaa
aataaacctttttggataggagagctccaatctggtcacggtgttacaggattgagattc
agcgttccagttgatgaattcgatgttgaaagatggtcatggctcgctatctcccatgat
gctaagggtttaaattactatgcctggcttcctatgagctgtggctatgaagtatcggga
ttcggcctggcaaattatgatggttcaatcaacaacaaggtaatcagggctggaaaagtc
tccgaaataatttctaagaacatgaatttattcttaaaagcaaaagctttgcaagctaag
gtagggatactttataacattgaaacccacaaaactctcgcttgtttaagggctgaaagt
gcggagatcatacgtgaagacatttttggcatgtacaaggccatgatgcaaatgggtgtt
aatgtggattttctgcatatatcggacttattgagagaagatcttaagcagtaccatctc
attatgattccattttccatcgttatagatcagaaaagtgctgatgcgatagagaaatat
gtgaggagcgggggagtagttttggcagatggacgtcttggatggatgaaagaagacgga
actttgcaagaaaaaatcccaggatccggtctggaaaaagtttttggttgtgaggaactc
tatacaagggaaatccaagaacaggctatcgattatgaagattgcaaactttctgcttat
cgatacttaactgtgtacagaaaaacaacaggcattccaaaagcattttttaatggccag
cctgttattgtagaaaacaaatatcattcaggactggcaataatggttggtatgctcatt
ggtcttgcctatgaaaaaacagaaaataggaacaatctggaattcttaaaacaaattgca
cagagagcaggcattaaccctgattactcaacttcaattacttctggtcaagaagattat
cttgaagtgagaatatcgcgttctgaggaaaaaacaatagtatttctatttaatcatggg
gacgaagcaattgaatttgatcttctgattccttcaaataatctacctgctctggtaaac
aatgtgaaatgtatcaacgctgatcaaaaattcgaatatcaagcatgcagcaaagcgtta
tcaatcaaaaatatcttcatacagggtaatcacactgttgttttgttgatcgagtga

DBGET integrated database retrieval system