KEGG   Thermotoga lettingae: Tlet_0220Help
Entry
Tlet_0220         CDS       T00618                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tle  Thermotoga lettingae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlet_0220
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_0220
   00052 Galactose metabolism
    Tlet_0220
   00500 Starch and sucrose metabolism
    Tlet_0220
   00520 Amino sugar and nucleotide sugar metabolism
    Tlet_0220
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tlet_0220
   00524 Butirosin and neomycin biosynthesis
    Tlet_0220
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tlet_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(229627..230502)
Genome map
AA seq 291 aa AA seqDB search
MYSFACDIGGTNLRIAIVDSDGKIYLKRKFSTPKKQDKLFENISQEFEKMNEKFEISHCI
FSIAGAVFEDGSVLIPNVFPQRIKLKETIRSFIPNVQIYIIDDRTAGLIGEICSGCARGF
KEVAYLIIGTGVGLGIFSQGQIIFGNQGIAGSAGWIHIKDPLTEEYRDIESLISGPAIAK
MFSRICGKEIESSESVLRLYLQKNTCATEVVKNVSFAMGYLLSTITNILNPEIIVLSGSV
GLNWKVFEEEAVKTLKKFTSPFITPPIIKVSSLGEDAQLVGCSKYTSLRKE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgtacagctttgcctgcgatatcggaggtacaaatttacgaatagctatcgttgattca
gacggcaaaatatatctcaaaagaaaattttccacaccaaaaaagcaggataaactgttc
gaaaacatttcacaggaatttgaaaaaatgaacgaaaaatttgaaatatcacattgtatt
ttttcaatagctggagctgttttcgaagacgggagtgttttaataccaaacgtgttccca
cagaggattaaacttaaagagacaatacgttcttttattccaaatgtacagatttacata
atagatgaccgtaccgcaggcctaattggagaaatatgcagtggatgtgccagaggattc
aaagaagtggcatatctgataattggtacaggagttggtcttggtattttctcacagggg
cagatcatttttgggaatcagggaatagcaggatcagcaggatggattcatataaaagat
cctttgacagaagaatacagagatattgagtcattaatatcaggaccagctatagcaaag
atgttttccagaatatgtggaaaagagatagaatccagtgaatctgtcttaagattgtat
ctacagaaaaacacgtgtgcaactgaggtagttaaaaatgtctcattcgcaatgggatat
cttctttcaacaattacaaatattctaaacccggagataatagttctctcaggaagtgtt
ggtttgaactggaaagtttttgaagaagaagctgttaaaacattgaaaaaattcaccagc
ccattcattactcctcccattataaaagtttcctccttaggcgaagatgcgcaactcgta
ggttgctcaaaatatacctctttgagaaaggagtga

DBGET integrated database retrieval system