KEGG   Thermotoga lettingae: Tlet_0265Help
Entry
Tlet_0265         CDS       T00618                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tle  Thermotoga lettingae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tlet_0265
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Tlet_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(283044..283850)
Genome map
AA seq 268 aa AA seqDB search
MIVGIGIDVVKIDRVELSLSKRILGPLEQLEFESIKDKKTYLAARFAAKEAFFKAIGTGV
KNYSFTDIEIIHNHAGKPLLLFHRGFYFNFAHISITHDFVAAAQIILEKRPGNVYIGVGS
NLEDRLKNIQQACNLMESRKIKIIKKSSIYETDPYGVKDQPDFYNCVLEVDTDFSVEELL
NMLLKIEQEMGRKREKKWGPRIIDLDILMYGNTVYKLPDLSVPHYDLINRQFVIVPLLEI
KAIDHPIYGELKNFVGERRDWRLVTKNW
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttggcattgggattgatgtagtcaaaatcgatagagtagaattgtctttaagc
aaaagaatcctcggaccattggagcaactggaattcgaatcaattaaggataagaaaaca
tatctggctgcaagattcgctgcgaaagaagctttcttcaaagcaatcggaacaggtgtg
aaaaattactctttcacagacatagagattatccacaaccatgccgggaaacctctttta
ctttttcacagaggtttttatttcaattttgctcatataagcatcacacatgatttcgta
gctgcagcacagataatactggaaaagcgccccgggaacgtttatattggagtgggttca
aatctcgaagataggttgaaaaatattcagcaagcctgcaatttgatggaatcgcgcaaa
ataaaaataataaaaaaatcctccatttatgagacagatccttatggagtgaaagatcaa
ccagatttctataattgtgttttagaagtagacacggatttttctgttgaagaattgttg
aacatgcttctaaaaatagagcaagaaatgggtagaaagcgtgagaaaaaatggggccca
agaattatcgatttggatattcttatgtatggaaatacagtatacaaattgccggattta
tcagttcctcattacgatttgatcaacagacaatttgtgatagttccattgctggaaatt
aaggcaatagatcatccaatctacggagaattgaaaaatttcgtgggggaaaggagagac
tggagattagtgacaaagaactggtga

DBGET integrated database retrieval system