KEGG   Thermotoga lettingae: Tlet_0469Help
Entry
Tlet_0469         CDS       T00618                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tle  Thermotoga lettingae
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tle01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tle00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
495741..497555
Genome map
AA seq 604 aa AA seqDB search
MILRVNLSTKKVVAERLNKMDLENFIGGRGIAAKILWDEVKHVDPLSESNKLIIAAGPYN
GLRTPSGGKLVVAAKSPLTGGYGDGNIGTMASVHLRKAGYMALVVEGASEKPVYIYIDNE
NVSILSAEGLWGLSTFETERKLKDVHGNNVGVLSIGPAGENLVKYAVIISQDGRAGGRPG
IGAVMGSKKLKAVVIRGTGDVQVRDVEAFKKYTTDVYKMIPTLPAYDFWMRQGTLATLEW
ANKNKALPVRNFGQVKFEYARTVDGYSMEAMKVTKRGCPNCNMICGNVVLDMEGKESELD
YENVGMLGPNMGMPFLNKVAVLNRLADEYGIDTISLGAVMGFIMEASEKGYVKGAPKFGD
YDNTIELVRKIAYRDGELANILADGVKEASEKLNLQHLAMHVKGLEVSAYNCYIYPAMAL
AYGTSAIGAHHKEAWVIAWEIGSTPLEEATTSEYVMTYTPEKARKVVEQQRIRGGLFEML
TACRLPWVELGVDLEWYAKILSAITGEQYTLDRLYEAADRVYSLIRCYWIREYRGKWNRH
MDYPPQRWFENDINGMKLERDKYDLLLSEYYKLRGWDSNGVPTPETLRRQKLDFAIEELG
DIIR
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgattttaagagtaaatctgtcaaccaaaaaagtagttgctgaaaggttgaacaaaatg
gaccttgaaaatttcatcggcgggagaggtatagctgcaaagattttgtgggatgaagta
aagcacgttgatccattatctgaaagcaacaaactcattatcgctgcaggaccttacaat
ggcttgagaactcccagtgggggaaaactcgtcgtggctgctaaaagtcccctgacagga
ggctacggtgatggaaatataggtaccatggcttcggtacatttgaggaaggctggttat
atggctttagttgttgaaggtgcaagtgagaaaccagtatacatttatattgataatgaa
aatgtgagtatattaagcgcagaagggttatggggattgagtacatttgaaacagagcga
aaattgaaagatgttcatggaaacaacgtaggagtgttgagcataggaccagctggagaa
aacttggtgaaatatgctgtcattatttctcaggatggaagagccgggggaagaccgggt
ataggggcagtcatgggaagcaaaaaattgaaggcggttgttataagagggacgggagat
gtccaggtaagagatgtagaggctttcaagaagtacacaacagatgtatacaaaatgatt
cccactcttcccgcttacgatttttggatgcgtcagggaacactggccactcttgagtgg
gcaaacaaaaataaagcccttccagttagaaattttgggcaggtgaaattcgaatatgcc
agaactgttgatggttattcaatggaagcgatgaaagttactaaaagaggatgtccaaat
tgcaatatgatttgtggtaacgtcgtacttgatatggaaggaaaagaaagtgaactggat
tatgagaatgttggaatgcttggcccaaatatgggcatgccttttttgaacaaggttgct
gttttaaacaggttggcggatgaatatggcattgacactatttcgctgggagcagtgatg
ggatttatcatggaagcttcggaaaaggggtatgtgaaaggcgcgccaaaatttggagat
tatgataacactatagaattggtcagaaagatagcttacagagatggggaactggcaaat
attctggcagatggcgttaaagaagcttcggaaaagctaaatctccagcatttagcaatg
catgtaaagggcttagaggtctctgcttataattgctatatatatcccgcaatggctctt
gcttatggaacgagcgccattggagctcatcataaagaagcgtgggtcatagcctgggaa
ataggatcaacacctcttgaagaagccacaacaagcgaatatgttatgacttatacgccg
gagaaagcaagaaaagttgttgagcagcaacgaataagaggtggactttttgaaatgctc
acagcttgtcgtttaccatgggtcgaacttggtgttgatctggagtggtatgcaaaaatc
ctcagcgcaataaccggagaacaatatacactggatagactttatgaagcagccgaccgg
gtatattcactcataagatgttactggatcagggaatatagaggcaaatggaacaggcac
atggattatccaccacagcgttggtttgaaaacgatataaatggtatgaaacttgaaagg
gataaatacgatctactgctgagcgaatattacaaacttcgaggctgggattcaaatggt
gtcccgacacccgaaacattgagaaggcaaaaattggattttgccatagaggaacttgga
gatattatcagataa

DBGET integrated database retrieval system