KEGG   Thermotoga lettingae: Tlet_0711Help
Entry
Tlet_0711         CDS       T00618                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tle  Thermotoga lettingae
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tlet_0711
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tlet_0711
Enzymes [BR:tle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tlet_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(726466..727857)
Genome map
AA seq 463 aa AA seqDB search
MNKTVDEFVLVNSNKLFDAASNLVKIKSVKSQPAGDGKPFGEGIAKALEAALNMGKQWGF
NVKNIDGYAGHIEYGTKGKLFAVLGHLDVVPEGDGWTVDPYGGIIKDGYLWGRGSSDDKG
PTVAAIFALKAVKESRINPKNRIRIILGCDEESGWEGVKHYFEKEEIPIYAVTPDANFPI
IYAEKGIINYTITQHLHKNKDTQVVLLKGGEASNMVPQEALAVLKPVREEILEKLKEFTP
QNGAKVFWNIDGDELKIKITGKSAHGSKPQTGVNAISALLDFLRTIDINCEDLSTFLRTI
FAKIGYETDGTSLRIAGTDCIAGPLTVNLGTLRMDPEKITAVINIRYPVFYSETMLTKQI
KEALKPLQVEPQNHLAPLFVSPDSELIKILSEIYTDVTGQKAELLTTGGGTYARAVPCGV
AFGPLLPGRLETEHQPDERIALDDLLLVARIYAQLFYKIMTEW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaaacggtcgacgaattcgtgcttgtaaacagcaataaattgtttgatgcagct
tcaaacctcgttaagatcaaatcagttaaatcccaacccgctggagatggtaaacctttt
ggagaaggaatcgcaaaggctcttgaggcagctttgaatatgggcaagcaatggggcttc
aatgtgaaaaacattgatgggtacgcaggacacatcgaatatggaactaaaggtaagtta
ttcgcggtccttggacatctggatgtggtaccagaaggtgacggatggacggtagatcca
tacggagggattataaaagatggctatttatggggaagagggtcttcagacgataaaggt
ccaactgtagcagccatctttgctttaaaagctgttaaagagtccaggattaatccgaaa
aatcgtattagaatcatccttggttgcgatgaagaatctggctgggaaggtgttaaacat
tattttgaaaaggaagaaattccgatatacgcagttacacctgatgcgaattttccaatt
atatatgctgaaaaaggaataataaactatacaataactcaacacctgcataaaaataaa
gacactcaggtcgtcctgctcaagggcggagaggcctcaaatatggtacctcaagaagct
ctggctgtattaaaacccgttagagaagaaatccttgaaaaattgaaagaattcactccc
cagaatggtgctaaagtgttctggaatattgacggagatgaattaaaaataaaaataaca
ggtaaatctgcccacgggtctaaaccacaaactggcgttaacgcaatatcagctttgctg
gactttctaaggactatcgatatcaattgcgaggacctatcaacgtttctgcgaaccatt
tttgcaaaaattgggtatgaaaccgatggaacttcattaagaattgccggtacagattgc
attgcaggacctttaactgttaatctcggaacactgaggatggatcctgaaaaaataact
gccgttattaatataagatatcctgtattttattctgaaacgatgctcaccaagcaaata
aaagaagcactcaagcctcttcaagttgaacctcaaaatcatcttgcccctctttttgtt
tctccagatagtgagctgataaaaatcttaagtgaaatctacaccgatgtaaccgggcag
aaagcagagcttcttacgacaggaggaggaacttatgcgagagctgtcccgtgtggtgtt
gcatttggcccgctgcttcctggaagattagaaacagaacatcaacccgatgagagaatt
gcattggacgatcttttactcgtagcaaggatttatgctcagcttttttataaaatcatg
acggagtggtga

DBGET integrated database retrieval system