KEGG   Thermotoga lettingae: Tlet_0765Help
Entry
Tlet_0765         CDS       T00618                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
tle  Thermotoga lettingae
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tle00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(778456..779868)
Genome map
AA seq 470 aa AA seqDB search
MVRVRFAPSPTGYLHVGGARTALFNYLFAKHHGGKFILRIEDTDIARSEGIFEENLMKTL
QWLGLNWDEGPDIGGSFGPYRQSERLNIYEEYAKKLIALDKAYEVFAYPEEIEEIREKLL
SKGLTPHYDRTIFEPFATKERKREYEEKGLKPAIYFSMPRKAFIHNDLVKGTVQFSEGSV
GDFAILRSNGIPTYNFACVVDDMLMQITHVIRGDDHLPNTVKQLALYEAFSARPPEIGHV
STILGPDGKKLSKRHGATSIEELRERGYLPQAVVNYLALLGWSSPDAKEIMSMQEMIERF
SIDRLSKNPAIFDPAKLSWMNGQYIRSTNEEELEQLLKPLLEKWNFIPRNQDWLRRVIIA
VKDRLHTLEDFQHVADFFFVKPEIKTETEYQIKCAMLECADKLESLDRSDKNSIVEVFRS
TIKKQKVSAKEFYSTLRYVLTGKHEGPELVDIVFLLGPNEVAARIKSILG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttggttagagtaagatttgcaccaagcccaaccggctatctccatgttggaggagcaaga
acagccctttttaattatctttttgcaaaacatcatggcggaaagttcattctgagaata
gaagatacagacatagcacgttcagaaggaattttcgaagaaaatcttatgaagacactt
caatggttaggactaaattgggatgaaggaccagatataggaggatctttcggcccatac
aggcaaagtgagcgattgaatatatacgaagaatatgcaaaaaaactaattgcccttgac
aaagcctatgaagtatttgcctatcccgaagaaatagaagagataagagaaaaactgctt
tcgaaagggctgaccccccattatgaccgcacaatcttcgaaccattcgctacaaaagaa
cgcaaaagagaatatgaagagaaaggattaaaaccagctatatatttttcaatgccaaga
aaggcctttattcacaatgatctggtaaaaggcaccgtgcaattttctgaaggttctgtg
ggagactttgctatactgagaagcaatgggataccaacttacaattttgcctgcgttgtt
gacgatatgctcatgcaaataacgcatgtcatacgtggggacgatcacttgccaaatact
gtgaaacaactcgcgctatatgaagccttttctgccagaccccctgaaattggacatgtt
tcgacaattctcgggccggatggaaagaaattgagtaagaggcatggtgcaacctcaatc
gaagaactcagagaaagaggatacctgcctcaagccgttgttaattatcttgccctgctt
ggatggtcttcaccagatgcaaaagaaataatgtccatgcaggaaatgattgaaagattc
tccatagatagacttagcaaaaatccggccatttttgacccagcaaaactcagctggatg
aacggccaatacataagatctacaaacgaagaggaactggagcaacttttaaaacctttg
ctggaaaaatggaatttcatacccaggaatcaggattggttacgcagagtaataattgct
gttaaggatagactccacactctggaagattttcaacatgttgcagatttcttctttgtg
aagccagagataaaaacggaaacggaatatcaaataaagtgtgccatgctcgaatgtgcc
gacaaacttgaaagccttgaccgttctgataaaaattctattgtggaagtattcaggtca
acaataaaaaaacaaaaggtgagtgcgaaagaattttacagcacgttgagatatgttctg
actggtaaacacgaaggaccagagcttgtggatattgtttttctcttaggtcctaatgaa
gtggcagcaagaatcaaatcaattttggggtga

DBGET integrated database retrieval system