KEGG   Thermotoga lettingae: Tlet_0902Help
Entry
Tlet_0902         CDS       T00618                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tle  Thermotoga lettingae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tle00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
922608..923789
Genome map
AA seq 393 aa AA seqDB search
MTDILVTEVSDPLSLLLKVGVDPASVPIFERKGKFISLMIYNVDVIAANVIKQEMLAAGA
DAAVNKHAITHKIQKTSVLTFGTIAQHIKLIEKLSKMHYWKLDQIADMIQKCLFKDQVRS
IDLPSGRKLIFDRTLIMGIVNVTPDSFYSKSRVEKDKVIDYTASMIKNGVDIIDIGAEST
RPGSERVSLEEELNRAIPAIEAIRKTFDIPISIDTYKSEVAKQAIMAGADIVNDVSALRF
DEKMIDVISEYKPAVVLMHMKGEPKTMQQNPYYEDVIEELLYFFNERLSMLGKIGLMDKV
IIDPGIGFGKRLSDNLQILKRIDEFKTFKVPILVGHSRKSFIGALLNNVPPEERLIATLA
VTAYCTMKKVDIIRIHDVAENSQVVRMISHLVR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacagatatattagtgacagaagttagtgaccctctttctctacttttaaaagtaggg
gttgatccagcatcggtaccaatttttgaaagaaaaggaaaatttatttcgttaatgatt
tacaatgtggatgtcatagctgcgaatgtaatcaagcaggaaatgcttgcagccggtgct
gatgccgctgtaaacaaacacgccatcacccacaaaattcaaaaaaccagtgtgctaact
ttcgggactattgctcaacatatcaaactgatagaaaaactttctaaaatgcattactgg
aagctcgatcagatagctgatatgattcaaaaatgccttttcaaggatcaggtaagatca
attgatttaccttcaggaagaaagctcatctttgatagaactctgataatggggattgtc
aatgtaacgcctgattctttttattcaaaaagccgggttgaaaaagataaggttatagat
tacacagcatcgatgatcaagaatggcgtggatataattgatataggcgctgaatcaact
cgccctggttctgagagggtatcacttgaggaagaactcaacagagcaatacctgcgatt
gaagcaatcagaaaaacctttgacattccgatctcgatagatacttataaatctgaggtt
gcaaaacaagctattatggctggtgcagatattgtaaatgatgtaagtgctttgagattc
gacgaaaaaatgattgatgtcatttctgagtacaaacccgccgttgttttgatgcacatg
aaaggtgagcctaaaacaatgcagcagaatccatattatgaagatgtaattgaagagctg
ctatactttttcaatgaaaggctttcaatgcttggaaaaattggtttgatggataaagta
attattgacccgggtatcggttttggaaaaagactgtcagataatctgcaaattttgaaa
agaatagatgagttcaaaacctttaaagtacctatcttagtaggccattccagaaaatct
tttatcggggcattgctaaataatgtaccccctgaagaaagattaattgccaccttagcg
gtgacagcttattgtacgatgaaaaaagttgatataataagaattcatgatgtcgctgaa
aattcgcaggttgttagaatgatatcgcaccttgtcagataa

DBGET integrated database retrieval system