KEGG   Thermotoga lettingae: Tlet_0915Help
Entry
Tlet_0915         CDS       T00618                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tle  Thermotoga lettingae
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tle00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tle00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tle00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
940596..943868
Genome map
AA seq 1090 aa AA seqDB search
MEWQDPEAVNENIEKPHATFIPYFNPFTACWEYPKQFIPLSGKWKFFFSNNPFDLPCNFY
DENFDDSSWDEIDVPSNWEMFGYDKPIYTNTTYPFGKNPPEISKNYNPTGIYRKTVIIPD
SWFDREIFLHFEGVRSFFYLWINGKRVGYSKDSCTPAEFRVNDYLKPGSNTLTVEVLKWC
DGSYLEDQDMWWLAGIYRDVYLYTTPRIYLRDIFVRTDLDEEFKNGKLFVDMEIKNSLAN
KIESTISISIVDPDGKESILKEERIILSHQLETLSYTFVLGKVFKWSVETPYLYVLKVKV
GEDEKKINTGFRKIQINHGRLLLNGKLLYIKGVNRHEFDPRRGHAVGVETMFKDIELMKQ
NNINTVRTSHYPNQTKWYDLCDYYGLYVIDEANIESHGVGWDPEETLANKPEWKKAHFDR
IQRMVERDKNHISVIFWSLGNEAGDGENFEYPALWIKSRDNTRMVHYAPYGAMKPGDAFY
LDVVSVMYPPIEKLLEYASKEQSRPLIMCEYAHAMGNSVGNLRDYWQVVENQPYLHGGCI
WDWVDQGFEKKDEAGGTFWAYGGDFGDEPNDGNFCCNGLVLPDRTPSPALSEVKKIYQYV
KVSRINRNLFEIENRYSCTNLSAFDIFWELKKDGKIVMSQKIDVELPAGERKTISINFPQ
LDNGEYFIIFLFLLKKDTVWAKKGHIVAWEQFQVKEPCYERISIKGNINLRENSNQYIVL
SKNVAVAFSKKTGFLEYIKLGEETILCKLAPNFYRAPTDNDLGNKMPERLFVWKEATYHQ
SLQKINFQIEKNYISIASLNRLPGDSLLHLTYTVFPNNEILIDYVLDARESRVEIPRVGT
SFTMPKSFTKVKWYGRGPHETYEDRKDSGIFSIHEKNVSEMIHKYIRPQETGNRTDVRWF
SISDERSSLFVYGVPVINFSVWPFSMESLEKAQHTNELIEQDLITVNVDYKQMGVGGDDS
WGALPHPEYILIPGIYHYEFRLLATNNTDSSEFYRRLPAFEEDYEISMSLSKQKLKVNEE
LVISVFIQNKSISTYEDDLLLFADEKLIDCQRVAVPPYETHRKDFSVKFVEKGTHLISIN
TKNKKPVYVF
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atggaatggcaagatcctgaagccgtgaatgaaaacatagagaaaccacacgcaacgttt
ataccttatttcaatcctttcacggcatgctgggaatatccgaaacagtttataccatta
agtggaaaatggaaattctttttttcaaataaccccttcgatttaccttgcaacttctat
gatgaaaattttgacgatagttcctgggatgaaatagatgtaccaagcaactgggaaatg
tttggatatgataagccgatatatacaaataccacataccccttcggaaaaaatccacca
gaaatttctaagaattacaaccctacaggtatatacagaaaaacggttattatacctgat
tcatggtttgatagagagatatttttacattttgaaggtgtcaggtcgtttttctatttg
tggataaatgggaaaagagttggttatagtaaagacagctgcacccccgctgaattcaga
gtgaacgattatttaaaaccgggaagtaatactctgaccgttgaggtattgaaatggtgc
gatggaagttatttagaagatcaagatatgtggtggcttgcaggaatatatagagatgtt
tatttatacacaacacccaggatatacctgcgagatatctttgtgagaacagatctcgat
gaagaattcaaaaatgggaaactatttgttgacatggaaatcaaaaattctcttgcaaat
aagattgaaagcacgatatcaatatcgatagttgatccagatggcaaagaatcgattttg
aaagaagaaagaataattctttcacatcagcttgaaactttatcgtatacctttgttttg
gggaaagttttcaagtggtctgttgaaactccgtatctgtatgttctgaaagtaaaggtc
ggcgaagatgagaaaaagataaatactggttttcgaaagatacagataaatcacggaaga
ttactcttgaatggaaaattgctgtatataaaaggggttaacaggcatgaattcgaccca
cgtcgtgggcatgccgtaggtgtggaaactatgttcaaagatattgaacttatgaagcaa
aataacataaacactgtgagaacgtcccattatcccaatcaaactaaatggtacgatctg
tgtgactattacggtctctatgttatagacgaagcaaatatagaatcacatggcgtggga
tgggacccggaggaaactcttgctaataaacctgaatggaagaaggcacattttgataga
attcaacgaatggttgaaagagataaaaatcacatcagtgtcatcttctggtctcttgga
aatgaggcaggggatggagaaaattttgagtatcctgctctgtggataaaatcacgagat
aacacgcgcatggtgcactatgcgccttatggtgcgatgaagcctggtgatgccttttat
cttgatgtagtttcggttatgtatccacctattgaaaaattgcttgagtatgcttcaaaa
gagcaaagcagacctttaataatgtgcgaatatgcccatgctatgggaaacagtgtgggt
aatctgagagattactggcaggtagtggaaaatcaaccttaccttcacggtggttgtata
tgggactgggttgatcaaggttttgagaagaaagatgaagccggtggaactttttgggct
tatggaggagattttggggatgaacccaatgacggaaatttttgctgtaatggattagtg
ctgcctgatagaactccttctccggcattaagtgaagtgaagaaaatttatcagtatgtg
aaagtcagcaggatcaacagaaatttgtttgagatagaaaacaggtattcctgcacaaat
ctcagtgcattcgatattttttgggaactgaaaaaagatgggaaaatcgtcatgagccag
aaaatcgatgtggagctaccagcaggagagcgaaaaacgatatcaataaattttccacag
ctggataatggggaatatttcataatttttttgtttttactgaaaaaagatacagtatgg
gcaaaaaaaggacacattgttgcctgggagcaatttcaagttaaagaaccgtgttacgaa
agaatatctatcaaaggtaatatcaatttgagggaaaatagcaatcagtacattgtttta
tcaaaaaacgttgcggttgctttttcaaaaaaaacagggtttctggaatatatcaaactt
ggagaggaaaccattttgtgcaaattagcacctaatttttacagagcacctacagacaac
gatttaggaaataaaatgccggaaagattgtttgtatggaaggaagcaacttatcaccaa
agtctgcagaagattaattttcaaatcgagaaaaactacataagtattgcttctttaaat
cgccttccaggagattcgctgctgcatttaacttatacggtttttcccaacaatgaaatc
ctgattgattatgttttagacgccagagaaagtcgtgtagaaattccaagagtcgggaca
agctttacgatgccgaaatcatttacgaaagtaaaatggtatggaagaggacctcatgaa
acgtacgaagatagaaaagacagtggaattttttcaatacatgagaagaatgtttctgag
atgattcataaatacataaggccacaagaaaccggtaatagaacagatgttcgatggttt
tccatatccgacgaaagatcttcactttttgtctatggtgttccagtgatcaatttcagc
gtctggcccttttccatggaaagtcttgaaaaagcccaacacacgaacgaattaattgaa
caggatttaatcaccgttaatgtagattacaaacaaatgggtgttggaggtgatgatagc
tggggggctttgccacatcctgaatacattctcataccgggaatttatcattatgaattc
agattgcttgcaactaataatacagattcatcagaattttatagacgcttacctgcattt
gaagaagactatgaaatcagtatgagtctttccaaacaaaagttaaaagtaaacgaagaa
ttggtgatttcagtatttatacagaacaaatcaatttcaacttatgaagacgatttactt
ctctttgcagacgagaagttaatcgactgtcaaagggtagctgtaccaccttacgaaact
cacagaaaagatttttcagtcaaatttgttgagaagggcactcatttgatcagtattaat
acgaaaaataaaaaacctgtatatgttttttga

DBGET integrated database retrieval system