KEGG   Thermotoga lettingae: Tlet_0996Help
Entry
Tlet_0996         CDS       T00618                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tle  Thermotoga lettingae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlet_0996
   01230 Biosynthesis of amino acids
    Tlet_0996
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_0996
   00051 Fructose and mannose metabolism
    Tlet_0996
   00562 Inositol phosphate metabolism
    Tlet_0996
Enzymes [BR:tle01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tlet_0996
Exosome [BR:tle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tlet_0996
  Exosomal proteins of bladder cancer cells
   Tlet_0996
  Exosomal proteins of melanoma cells
   Tlet_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1023638..1024363)
Genome map
AA seq 241 aa AA seqDB search
MNKTNEQAKFFVNKLVQDLAGMNFKIVLCPPFVCLSDITEILKGSNLHIGAQNCYYENFG
AFTGEISPVMLKELNIEYVIIGHSERRHIFGETDEMINKKIKAVLSNGMKPIICIGETKE
EREKGLTFCVIESQLRQALFGLNEDDVRKIVIAYEPVWAIGTGIVAKPHQAQQVHMFIRK
LLEQLYGQEFAQQIPILYGGSIKPDNFLGLMIQPDIDGGLVGGASLDDQFVELAKIASWL
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaactaatgaacaggctaaattctttgttaataaacttgttcaggatctggcg
ggtatgaatttcaagatagtattgtgcccgccttttgtttgcctctccgatattacagaa
atactcaagggaagtaacttacatataggtgcacagaattgttattacgaaaattttgga
gccttcaccggtgaaatctctcctgtgatgcttaaggaattgaatattgaatatgtaatc
atcggccattccgaacgtcgtcacatttttggtgaaacagatgaaatgatcaacaaaaag
atcaaagctgtactcagcaatggtatgaaaccaatcatatgtattggtgaaacaaaagaa
gagagggaaaagggattaaccttttgcgtcattgaatctcagctgagacaagcattgttt
ggtctgaacgaagatgatgtcagaaagattgtaatagcttatgagccagtgtgggctatt
ggaacggggatagttgcaaaaccacatcaggctcaacaagtgcatatgtttatacgaaag
ttgcttgaacaactttatggtcaggaatttgctcagcagatacccattttatatggaggt
agcattaagcctgataatttccttgggttaatgattcagccggatattgatggcggcctg
gtaggtggagcaagtcttgatgatcagtttgttgaacttgcaaagatagcctcctggtta
gtataa

DBGET integrated database retrieval system