KEGG   Pseudothermotoga lettingae: Tlet_0996Help
Entry
Tlet_0996         CDS       T00618                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00010  Glycolysis / Gluconeogenesis
tle00051  Fructose and mannose metabolism
tle00562  Inositol phosphate metabolism
tle01100  Metabolic pathways
tle01110  Biosynthesis of secondary metabolites
tle01120  Microbial metabolism in diverse environments
tle01130  Biosynthesis of antibiotics
tle01200  Carbon metabolism
tle01230  Biosynthesis of amino acids
Module
tle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tle_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_0996
   00051 Fructose and mannose metabolism
    Tlet_0996
   00562 Inositol phosphate metabolism
    Tlet_0996
Enzymes [BR:tle01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tlet_0996
Exosome [BR:tle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tlet_0996
  Exosomal proteins of bladder cancer cells
   Tlet_0996
  Exosomal proteins of melanoma cells
   Tlet_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABV33562
JGI: Tlet0996
UniProt: A8F5X8
Position
complement(1023638..1024363)
Genome map
AA seq 241 aa AA seqDB search
MNKTNEQAKFFVNKLVQDLAGMNFKIVLCPPFVCLSDITEILKGSNLHIGAQNCYYENFG
AFTGEISPVMLKELNIEYVIIGHSERRHIFGETDEMINKKIKAVLSNGMKPIICIGETKE
EREKGLTFCVIESQLRQALFGLNEDDVRKIVIAYEPVWAIGTGIVAKPHQAQQVHMFIRK
LLEQLYGQEFAQQIPILYGGSIKPDNFLGLMIQPDIDGGLVGGASLDDQFVELAKIASWL
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaactaatgaacaggctaaattctttgttaataaacttgttcaggatctggcg
ggtatgaatttcaagatagtattgtgcccgccttttgtttgcctctccgatattacagaa
atactcaagggaagtaacttacatataggtgcacagaattgttattacgaaaattttgga
gccttcaccggtgaaatctctcctgtgatgcttaaggaattgaatattgaatatgtaatc
atcggccattccgaacgtcgtcacatttttggtgaaacagatgaaatgatcaacaaaaag
atcaaagctgtactcagcaatggtatgaaaccaatcatatgtattggtgaaacaaaagaa
gagagggaaaagggattaaccttttgcgtcattgaatctcagctgagacaagcattgttt
ggtctgaacgaagatgatgtcagaaagattgtaatagcttatgagccagtgtgggctatt
ggaacggggatagttgcaaaaccacatcaggctcaacaagtgcatatgtttatacgaaag
ttgcttgaacaactttatggtcaggaatttgctcagcagatacccattttatatggaggt
agcattaagcctgataatttccttgggttaatgattcagccggatattgatggcggcctg
gtaggtggagcaagtcttgatgatcagtttgttgaacttgcaaagatagcctcctggtta
gtataa

DBGET integrated database retrieval system