KEGG   Thermotoga lettingae: Tlet_0996Help
Entry
Tlet_0996         CDS       T00618                                 

Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tle  Thermotoga lettingae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlet_0996
   01230 Biosynthesis of amino acids
    Tlet_0996
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_0996
   00051 Fructose and mannose metabolism
    Tlet_0996
   00562 Inositol phosphate metabolism
    Tlet_0996
Enzymes [BR:tle01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tlet_0996
Exosome [BR:tle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tlet_0996
  Exosomal proteins of bladder cancer cells
   Tlet_0996
  Exosomal proteins of melanoma cells
   Tlet_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1023638..1024363)
Genome map
AA seq 241 aa AA seqDB search
MNKTNEQAKFFVNKLVQDLAGMNFKIVLCPPFVCLSDITEILKGSNLHIGAQNCYYENFG
AFTGEISPVMLKELNIEYVIIGHSERRHIFGETDEMINKKIKAVLSNGMKPIICIGETKE
EREKGLTFCVIESQLRQALFGLNEDDVRKIVIAYEPVWAIGTGIVAKPHQAQQVHMFIRK
LLEQLYGQEFAQQIPILYGGSIKPDNFLGLMIQPDIDGGLVGGASLDDQFVELAKIASWL
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaactaatgaacaggctaaattctttgttaataaacttgttcaggatctggcg
ggtatgaatttcaagatagtattgtgcccgccttttgtttgcctctccgatattacagaa
atactcaagggaagtaacttacatataggtgcacagaattgttattacgaaaattttgga
gccttcaccggtgaaatctctcctgtgatgcttaaggaattgaatattgaatatgtaatc
atcggccattccgaacgtcgtcacatttttggtgaaacagatgaaatgatcaacaaaaag
atcaaagctgtactcagcaatggtatgaaaccaatcatatgtattggtgaaacaaaagaa
gagagggaaaagggattaaccttttgcgtcattgaatctcagctgagacaagcattgttt
ggtctgaacgaagatgatgtcagaaagattgtaatagcttatgagccagtgtgggctatt
ggaacggggatagttgcaaaaccacatcaggctcaacaagtgcatatgtttatacgaaag
ttgcttgaacaactttatggtcaggaatttgctcagcagatacccattttatatggaggt
agcattaagcctgataatttccttgggttaatgattcagccggatattgatggcggcctg
gtaggtggagcaagtcttgatgatcagtttgttgaacttgcaaagatagcctcctggtta
gtataa

DBGET integrated database retrieval system