KEGG   Pseudothermotoga lettingae: Tlet_1320Help
Entry
Tlet_1320         CDS       T00618                                 

Definition
(GenBank) ABC transporter related
  KO
K02003  
putative ABC transport system ATP-binding protein
Organism
tle  Pseudothermotoga lettingae
Module
Putative ABC transport system
Brite
Transporters [BR:tle02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    Tlet_1320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1377483..1378160)
Genome map
AA seq 225 aa AA seqDB search
MIKVKNLWKIYGEGEGAVQALKGINITIEHGEFLAILGPSGSGKTTLLNCLSGIDAPTRG
EIFFNGVAFHSMSEEKKTQFRAKYMGFIFQFFNLVPVLTAIENVELPLKILGVKHTEARN
RALEMLKKVGLSDKINRFPSQLSGGEQQRVAIARAIIHNPDIIWADEPTGNLDSETGLGI
IELLERIRNEHGTTLVIVTHDERIAKRADRVLTIRDGKILSFSTF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagtaaaaaatctgtggaaaatctatggtgaaggagaaggggctgtacaggct
cttaaaggcataaatattactatagagcacggagagtttcttgccatacttggaccatct
ggttctggcaaaaccacgttgcttaattgtctttctggaattgatgctccgacacgcggt
gagatttttttcaatggggtggcttttcattcgatgagtgaagagaaaaagacgcaattt
cgagcaaaatatatgggtttcattttccaatttttcaacctggtacctgtgcttactgct
attgagaatgtggaattgcctcttaagattctcggcgtgaaacatactgaagcaaggaat
agagctcttgaaatgctgaaaaaagttggtttatcagacaaaatcaacaggtttccatct
cagctttcaggtggtgaacagcagagggtagccatagcaagagcgattattcacaatcca
gatataatatgggctgatgaaccaaccggaaatctcgattcagaaaccggacttggcata
atagagctgcttgaaagaatcaggaatgaacatggaacaacactggtaatcgttactcac
gatgaacgaatagcaaagcgagcagatcgtgtgcttactataagagacggtaagattctg
agtttttctacgttttga

DBGET integrated database retrieval system