KEGG   Thermotoga lettingae: Tlet_1320Help
Entry
Tlet_1320         CDS       T00618                                 

Definition
ABC transporter-like protein
Orthology
K02003  
putative ABC transport system ATP-binding protein
Organism
tle  Thermotoga lettingae
Module
Putative ABC transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1377483..1378160)
Genome map
AA seq 225 aa AA seqDB search
MIKVKNLWKIYGEGEGAVQALKGINITIEHGEFLAILGPSGSGKTTLLNCLSGIDAPTRG
EIFFNGVAFHSMSEEKKTQFRAKYMGFIFQFFNLVPVLTAIENVELPLKILGVKHTEARN
RALEMLKKVGLSDKINRFPSQLSGGEQQRVAIARAIIHNPDIIWADEPTGNLDSETGLGI
IELLERIRNEHGTTLVIVTHDERIAKRADRVLTIRDGKILSFSTF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagtaaaaaatctgtggaaaatctatggtgaaggagaaggggctgtacaggct
cttaaaggcataaatattactatagagcacggagagtttcttgccatacttggaccatct
ggttctggcaaaaccacgttgcttaattgtctttctggaattgatgctccgacacgcggt
gagatttttttcaatggggtggcttttcattcgatgagtgaagagaaaaagacgcaattt
cgagcaaaatatatgggtttcattttccaatttttcaacctggtacctgtgcttactgct
attgagaatgtggaattgcctcttaagattctcggcgtgaaacatactgaagcaaggaat
agagctcttgaaatgctgaaaaaagttggtttatcagacaaaatcaacaggtttccatct
cagctttcaggtggtgaacagcagagggtagccatagcaagagcgattattcacaatcca
gatataatatgggctgatgaaccaaccggaaatctcgattcagaaaccggacttggcata
atagagctgcttgaaagaatcaggaatgaacatggaacaacactggtaatcgttactcac
gatgaacgaatagcaaagcgagcagatcgtgtgcttactataagagacggtaagattctg
agtttttctacgttttga

DBGET integrated database retrieval system