KEGG   Thermotoga lettingae: Tlet_1331Help
Entry
Tlet_1331         CDS       T00618                                 

Definition
carbohydrate kinase FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tle  Thermotoga lettingae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tlet_1331
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tlet_1331
Exosome [BR:tle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tlet_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1389603..1391063
Genome map
AA seq 486 aa AA seqDB search
MEKYILAIDQSTTGTKAILFDHKLNLVKRATEHHTQYYPRPGWIEHDPKEILKKTFLACK
NLLKDINPQNIAAVSVANQRETTVMWNKDGEPIYNAIVWQCQRGKNICEKLKEKGYEKTI
KQKTGLLIDPYFSASKVAWILENVEKLKYRIQSENIFFGTIDSWLIYNLCENHPHLTDYS
NASRTMLFNIHSLEWDKEILDLFKIPIKIMPGLLPSDEIFGYTDLNGILPKKIPIIGVMG
DSSAALYGQMGHNYGDSKATYGTGTSIMINLQNKKPILNSGVLSIGWVVNGKTTYVAEGN
IHSSGDTLKWITEQLELAKMDEIEELAISVDSNNGVYFVPAFNGLGAPYWKNKARAIICG
ISRGTTKAHLVRAAVESIAFQVNDLFSSLVEETKLQPSNLKVDGGATKNRFLMQFQADIL
NLPVYVNNVEECSARGVALIAANKIGLVQFDEIPINYTKYLPNMPSDIRDKYLKEWHIAV
RRTISC
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaatacatactcgcgattgatcaaagcacaacaggaacaaaagctattcttttt
gatcacaaactgaaccttgtcaaaagagctactgaacaccacactcaatactatccacga
cccggatggattgaacacgatccaaaggaaatcttgaaaaaaacatttctggcatgcaaa
aatcttttgaaagacataaatcctcaaaatatcgcagccgtgagtgttgccaatcaacgc
gaaacaactgtaatgtggaacaaagatggagaacccatatacaatgcgatagtatggcag
tgtcagcgcgggaaaaacatatgtgaaaaattaaaagaaaaaggttatgaaaaaaccata
aagcagaaaacagggttattaatagacccatatttttctgcaagcaaagttgcgtggatt
ctggagaacgtggagaaactcaagtacagaattcaaagcgaaaatatattctttggaaca
atcgattcatggctaatttacaacctctgtgagaatcacccccatctaacagattattct
aatgccagtaggaccatgttgttcaatatccattcactagaatgggacaaagaaatactt
gatcttttcaaaatacctatcaaaattatgccgggattgcttccttccgatgagatcttc
ggttataccgatttgaacggtattctgccaaagaagattccaattattggtgtcatggga
gattcaagtgccgctctatatggtcagatgggtcacaattatggagattccaaagccact
tatggcacaggaacgtctataatgatcaatcttcaaaacaaaaaacctattttgaatagc
ggggttctctcgattggttgggtagttaatggcaaaacaacttacgttgcagaaggaaat
attcacagttctggggatactctgaaatggattaccgagcaacttgaacttgcaaaaatg
gatgaaatagaagagctcgcaataagtgttgatagcaacaatggggtttatttcgtacca
gctttcaatgggctgggtgctccatactggaaaaacaaagcccgcgccatcatctgtgga
ataagcagaggaacaacaaaggcacatttagtcagagcagctgttgaatcaattgccttt
caggtgaacgatctgttttcatccttagtggaagaaacaaaacttcagccttcgaatctc
aaagttgatggaggggcaaccaaaaatagatttttaatgcagtttcaggccgatatactg
aatctgccggtttatgtaaacaacgtagaagaatgctctgcccgtggtgttgcgctaatt
gcagcaaataagattgggctcgtacagttcgatgaaattccgataaattacacaaaatac
ttaccaaatatgccatctgacataagagataagtacttaaaagaatggcacattgctgta
aggcgaactatatcatgctga

DBGET integrated database retrieval system