KEGG   Pseudothermotoga lettingae: Tlet_1387Help
Entry
Tlet_1387         CDS       T00618                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00052  Galactose metabolism
tle00561  Glycerolipid metabolism
tle00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tlet_1387
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tlet_1387
   00600 Sphingolipid metabolism
    Tlet_1387
Enzymes [BR:tle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tlet_1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABV33944
JGI: Tlet1387
UniProt: A8F710
Position
complement(1447518..1448966)
Genome map
AA seq 482 aa AA seqDB search
MAPVKISIIGAGSAVFSMRLVNDLCKTSGLAGSLVSLMDIDEKRLNAVHNLATRYVKELG
ADLRFEKTTQLEVSLRDADFVINTAMVGGHSYLEKARRIGEKHGYYRGIDTQELNMVSDY
YTLSNFNQLKFFVDLAKLMENICPNAWLLQTANPVFEGTNLIKRCSDIKVVGFCHGHYGV
HEIVEALGLDIKRVDWQVVGFNHAIWLNRFSYDGENGYDLIDKWIEENSKDWKPKTPFDL
QLSPAAIDMYRFYGLMPIGDTVRNSTWKYNYDLQLKKKWYGEPWGGADSEIGWQWYQERL
KMITEAIDYLSSNNALKLLSLESYLKFLPKGSVPEELKEEIKIFTSKDALSGEQHIPFID
AVVNNNAQRFVINIPNKGYLSQIPDGVVVEVPALVNKSGWHVEKIDPPLNEKVVKMYLIP
RMLRMEWALEAIMNGDKEILVEILLRDVRTQSYEQAVEVIEEILSLPENEPMRNHYSKKK
RL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcacctgtgaaaatcagtattatcggggcaggaagtgcggttttttctatgaggctt
gttaacgatctctgtaaaacttctggattagcaggaagtcttgtttctctaatggacatc
gacgaaaagcggcttaacgcagttcataatctggcaacaagatatgtaaaagagctcggg
gctgatttgagatttgagaaaaccacgcagctcgaggtttcacttagagatgcagatttt
gtgataaatacggctatggtagggggacattcttatctcgaaaaagcgcgcagaataggt
gaaaagcacgggtattacagaggtatagacacgcaggaattaaacatggtttcagattat
tacaccctgagcaattttaaccagcttaagttttttgtcgatctagcaaagttgatggaa
aatatatgcccgaatgcctggcttttgcaaactgcaaatcccgtttttgagggaaccaat
ttaatcaagcgctgctctgatattaaagtagttggcttctgtcatggccattatggagtt
catgaaatagttgaggcacttggacttgacatcaaaagagttgactggcaagtagtgggt
tttaatcatgctatctggctcaacagattttcgtacgatggtgaaaatggatatgatcta
attgacaaatggatcgaagaaaactcaaaagactggaagccaaaaacaccgtttgatctt
caattaagtcctgctgcaattgatatgtacagattttatggtttgatgcccataggagat
actgtcagaaacagtacgtggaaatataattacgatcttcaattgaagaaaaaatggtat
ggagaaccgtggggcggagctgattcagagataggatggcaatggtatcaggaaagattg
aaaatgataaccgaggcgatagattatctatcttccaacaacgctttgaagcttttgtct
ttggaatcatatttgaaatttttgccgaaaggctctgtacccgaagaattgaaagaagaa
atcaagatttttacatcaaaagacgctctgagtggcgagcagcatataccttttattgac
gcagtggtgaataacaacgctcagaggtttgttataaatattccgaataaaggttatcta
tctcagatacctgacggagttgttgtggaagtacccgcattggttaataaaagtggctgg
catgtggaaaaaatagatcctccgttgaatgaaaaggttgtaaaaatgtatttgatacca
aggatgctcaggatggaatgggcacttgaagctattatgaatggtgataaagagattctt
gtagaaattcttttaagagatgtcagaacacaatcttacgagcaggcagtggaagttata
gaagagatcctttctttacctgaaaacgaaccgatgagaaatcactatagcaagaaaaag
agattgtga

DBGET integrated database retrieval system