KEGG   Thermotoga lettingae: Tlet_1387Help
Entry
Tlet_1387         CDS       T00618                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tle  Thermotoga lettingae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tle00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tle00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tle00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1447518..1448966)
Genome map
AA seq 482 aa AA seqDB search
MAPVKISIIGAGSAVFSMRLVNDLCKTSGLAGSLVSLMDIDEKRLNAVHNLATRYVKELG
ADLRFEKTTQLEVSLRDADFVINTAMVGGHSYLEKARRIGEKHGYYRGIDTQELNMVSDY
YTLSNFNQLKFFVDLAKLMENICPNAWLLQTANPVFEGTNLIKRCSDIKVVGFCHGHYGV
HEIVEALGLDIKRVDWQVVGFNHAIWLNRFSYDGENGYDLIDKWIEENSKDWKPKTPFDL
QLSPAAIDMYRFYGLMPIGDTVRNSTWKYNYDLQLKKKWYGEPWGGADSEIGWQWYQERL
KMITEAIDYLSSNNALKLLSLESYLKFLPKGSVPEELKEEIKIFTSKDALSGEQHIPFID
AVVNNNAQRFVINIPNKGYLSQIPDGVVVEVPALVNKSGWHVEKIDPPLNEKVVKMYLIP
RMLRMEWALEAIMNGDKEILVEILLRDVRTQSYEQAVEVIEEILSLPENEPMRNHYSKKK
RL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcacctgtgaaaatcagtattatcggggcaggaagtgcggttttttctatgaggctt
gttaacgatctctgtaaaacttctggattagcaggaagtcttgtttctctaatggacatc
gacgaaaagcggcttaacgcagttcataatctggcaacaagatatgtaaaagagctcggg
gctgatttgagatttgagaaaaccacgcagctcgaggtttcacttagagatgcagatttt
gtgataaatacggctatggtagggggacattcttatctcgaaaaagcgcgcagaataggt
gaaaagcacgggtattacagaggtatagacacgcaggaattaaacatggtttcagattat
tacaccctgagcaattttaaccagcttaagttttttgtcgatctagcaaagttgatggaa
aatatatgcccgaatgcctggcttttgcaaactgcaaatcccgtttttgagggaaccaat
ttaatcaagcgctgctctgatattaaagtagttggcttctgtcatggccattatggagtt
catgaaatagttgaggcacttggacttgacatcaaaagagttgactggcaagtagtgggt
tttaatcatgctatctggctcaacagattttcgtacgatggtgaaaatggatatgatcta
attgacaaatggatcgaagaaaactcaaaagactggaagccaaaaacaccgtttgatctt
caattaagtcctgctgcaattgatatgtacagattttatggtttgatgcccataggagat
actgtcagaaacagtacgtggaaatataattacgatcttcaattgaagaaaaaatggtat
ggagaaccgtggggcggagctgattcagagataggatggcaatggtatcaggaaagattg
aaaatgataaccgaggcgatagattatctatcttccaacaacgctttgaagcttttgtct
ttggaatcatatttgaaatttttgccgaaaggctctgtacccgaagaattgaaagaagaa
atcaagatttttacatcaaaagacgctctgagtggcgagcagcatataccttttattgac
gcagtggtgaataacaacgctcagaggtttgttataaatattccgaataaaggttatcta
tctcagatacctgacggagttgttgtggaagtacccgcattggttaataaaagtggctgg
catgtggaaaaaatagatcctccgttgaatgaaaaggttgtaaaaatgtatttgatacca
aggatgctcaggatggaatgggcacttgaagctattatgaatggtgataaagagattctt
gtagaaattcttttaagagatgtcagaacacaatcttacgagcaggcagtggaagttata
gaagagatcctttctttacctgaaaacgaaccgatgagaaatcactatagcaagaaaaag
agattgtga

DBGET integrated database retrieval system