KEGG   Thermotoga lettingae: Tlet_1443Help
Entry
Tlet_1443         CDS       T00618                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tle  Thermotoga lettingae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tle00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tle00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tle00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1509411..1510994
Genome map
AA seq 527 aa AA seqDB search
MEMFSSRIREGNFVLNEKNYSIKWTTKQIENGWKITGFIKGKPGRIEFFKTYSSKKILIN
NWQSWGPCKVINTDHLKLPRQIDDNWQYTTSLFPDIFEKQIQSDYFILEENKLYGFLSSR
IAHPFFTVQKNAMTAYIDYFDAVFDEYVPLETFVILEGADESFLLEKYGELIAKENNVSI
RKQSIIGWCSWYQYFLNLTWQEILKNINLASNYPFEVFQIDDGYEKDIGDWLIVKDGFPQ
LYQMAETIAKSGMKPGIWIAPFCVSESSSISQNHPDWLVKEEERPKVAFRNWDHQIFSLD
LSKSEVKKWLYELFSTLRKMGYLYFKIDFLFSGAIPGKRHNGSTPIQVFREGLEVIRKAV
KDAFILGCGSPLLPAVGFVDGMRVGPDTTPFWGENVPDEGAPAAKWSLRNAITRHFMHRK
LWLNDPDCLLLRSEQTSLTLNERELYAYTCGVLDNIIVVSDDLSLIDDQSKEILNKTLRL
ISGSAFVKNIMSTDGYEIISRGTKSGDVKLFVDLEKRIFSLEIKTER
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggagatgttcagcagcagaataagggaaggtaattttgtactgaatgagaagaattat
tcaataaaatggactactaaacagattgaaaatggatggaaaataacaggattcatcaaa
ggaaaacccgggagaattgaattcttcaaaacctattcttcgaaaaaaattttgataaac
aactggcaatcatgggggccatgtaaagtgatcaatacagaccatcttaagttgccaaga
cagatagatgataactggcaatacactacctccctgtttccagatatctttgagaaacaa
attcaaagcgactatttcatactcgaagaaaataaactgtacggctttctcagttcaaga
attgcccacccatttttcacagttcagaaaaatgctatgacagcctatatagactacttc
gatgcagtatttgatgaatacgttcctttagaaacattcgttattctggaaggtgctgat
gaatcttttttattggagaaatacggtgaactcattgcaaaagaaaacaatgtttctatt
agaaaacaaagcataataggatggtgcagctggtatcagtattttttgaatctgacatgg
caggaaatattgaaaaatataaaccttgcctcaaattatcctttcgaggttttccagata
gatgatggttatgaaaaagatataggagattggttaatagtaaaagacggctttcctcaa
ctttatcaaatggcagaaactatagcaaaaagtgggatgaaaccgggcatctggatagca
ccgttttgcgtttcagaaagctcaagcatttctcaaaaccatccagactggcttgtaaaa
gaggaggagcggccgaaagtagctttcagaaactgggaccatcaaatattctccttggat
ctttctaaaagtgaagtaaaaaaatggctttacgaattattttcaacactgagaaaaatg
gggtacctctatttcaaaatagattttcttttctcaggggcaattcctggaaaaaggcat
aatggatcaactccaatacaagtatttagagaaggacttgaggttataagaaaagcagta
aaagatgctttcattctcggctgtggatcaccacttctaccggctgttggatttgtggat
ggcatgagagtaggtcccgacacaacacctttctggggggaaaatgtaccagatgagggt
gctccagctgcaaaatggtccttgagaaatgcaataacaaggcatttcatgcacagaaaa
ctctggttgaatgacccggattgtcttttgctccgtagcgaacaaaccagcttaacactc
aacgaaagagagctgtatgcctacacgtgcggtgtacttgacaacataatcgtagtaagt
gatgatttatctctgattgatgatcaaagcaaagaaatcctcaacaaaactttgagatta
atatccgggagtgcgtttgtgaaaaacattatgtctacagatggttatgaaatcatctca
cgtggtactaaatcaggtgatgtgaagctctttgtggatctggaaaaaagaatattttcc
cttgaaataaaaacagagaggtga

DBGET integrated database retrieval system