KEGG   Thermotoga lettingae: Tlet_1461Help
Entry
Tlet_1461         CDS       T00618                                 

Definition
succinate--CoA ligase (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tle  Thermotoga lettingae
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tle01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tle00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tle00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1532663..1533739
Genome map
AA seq 358 aa AA seqDB search
MYSSPIAEGYLGNFCLCGGEDMKIHEYVGKNVLKENGFNVPKSVLINGPFERRDLEQLDL
PHVLKAQVLVGGRMKAGGVVFSRSYEETYQKISYLLGRKIKGEKCTKVLVEEVFEHDREE
YLSILIDRDIRDITVLYSEFGGIDIEDVEKQKIVKIKMEDISKLPDHVRDITYKLVNLFI
EKDLTLLEINPIAFNNKDEYMMLDCVMHIDENALYRQNWCPQIPSFDPELQGDVGIIGCG
AGIVMATFDAVIECGLKPGAFCDLGGGAKKENALKVLNDLSKRNKKIVANIFGGITDTME
IASAIIECKGKNPEIQIFARITGNNEMFSRKLLTENGIKVFDSTTDLINALRRESYVL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgtattcttccccgatagctgagggctatttgggaaatttttgtttgtgtggaggtgag
gatatgaaaattcacgaatatgtcggaaaaaatgttctaaaagaaaacggatttaatgta
ccaaaatccgtattgatcaacgggccttttgaacgaagagatcttgaacaactcgatctt
ccacatgttttgaaagcccaggttctggttggagggagaatgaaagctggtggtgtggtt
ttctccagatcatacgaagaaacttaccagaaaatttcatatctacttggaagaaaaata
aaaggagaaaagtgtacaaaggtgctcgttgaggaagtttttgaacacgatagagaagaa
tatttatcaatattgattgatagagacattagagatataacagtactctattccgaattc
ggcgggattgatatagaagatgtggaaaagcaaaaaatagtcaaaattaagatggaagat
atcagtaaattaccagatcacgtacgtgatataacttataaactggtaaatctttttata
gaaaaagatttgacacttcttgaaattaatccgatcgctttcaacaacaaagatgaatat
atgatgctggattgtgttatgcatatcgatgaaaatgctctttatagacaaaattggtgt
ccacaaattcccagctttgatcctgaacttcaaggtgatgtgggaataattggttgtgga
gccggtattgtcatggcaactttcgatgcagttatcgaatgcggccttaaacccggcgct
ttctgcgatctcggcggcggagcaaaaaaagaaaatgcactgaaagtgttaaatgatcta
agtaaaagaaataaaaaaatagtcgcaaatatattcggtggtattaccgatactatggaa
attgcttcagcaatcatcgaatgtaaagggaagaacccggaaattcaaatcttcgcccga
ataacaggaaacaatgagatgttttccagaaaacttttaacagaaaatggaataaaggtt
ttcgacagcaccacagatcttataaacgctctaaggagggagagctatgttttgtaa

DBGET integrated database retrieval system