KEGG   Thermotoga lettingae: Tlet_1461Help
Entry
Tlet_1461         CDS       T00618                                 

Definition
succinate--CoA ligase (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tle  Thermotoga lettingae
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlet_1461
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tlet_1461
   00640 Propanoate metabolism
    Tlet_1461
   00660 C5-Branched dibasic acid metabolism
    Tlet_1461
Enzymes [BR:tle01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tlet_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1532663..1533739
Genome map
AA seq 358 aa AA seqDB search
MYSSPIAEGYLGNFCLCGGEDMKIHEYVGKNVLKENGFNVPKSVLINGPFERRDLEQLDL
PHVLKAQVLVGGRMKAGGVVFSRSYEETYQKISYLLGRKIKGEKCTKVLVEEVFEHDREE
YLSILIDRDIRDITVLYSEFGGIDIEDVEKQKIVKIKMEDISKLPDHVRDITYKLVNLFI
EKDLTLLEINPIAFNNKDEYMMLDCVMHIDENALYRQNWCPQIPSFDPELQGDVGIIGCG
AGIVMATFDAVIECGLKPGAFCDLGGGAKKENALKVLNDLSKRNKKIVANIFGGITDTME
IASAIIECKGKNPEIQIFARITGNNEMFSRKLLTENGIKVFDSTTDLINALRRESYVL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgtattcttccccgatagctgagggctatttgggaaatttttgtttgtgtggaggtgag
gatatgaaaattcacgaatatgtcggaaaaaatgttctaaaagaaaacggatttaatgta
ccaaaatccgtattgatcaacgggccttttgaacgaagagatcttgaacaactcgatctt
ccacatgttttgaaagcccaggttctggttggagggagaatgaaagctggtggtgtggtt
ttctccagatcatacgaagaaacttaccagaaaatttcatatctacttggaagaaaaata
aaaggagaaaagtgtacaaaggtgctcgttgaggaagtttttgaacacgatagagaagaa
tatttatcaatattgattgatagagacattagagatataacagtactctattccgaattc
ggcgggattgatatagaagatgtggaaaagcaaaaaatagtcaaaattaagatggaagat
atcagtaaattaccagatcacgtacgtgatataacttataaactggtaaatctttttata
gaaaaagatttgacacttcttgaaattaatccgatcgctttcaacaacaaagatgaatat
atgatgctggattgtgttatgcatatcgatgaaaatgctctttatagacaaaattggtgt
ccacaaattcccagctttgatcctgaacttcaaggtgatgtgggaataattggttgtgga
gccggtattgtcatggcaactttcgatgcagttatcgaatgcggccttaaacccggcgct
ttctgcgatctcggcggcggagcaaaaaaagaaaatgcactgaaagtgttaaatgatcta
agtaaaagaaataaaaaaatagtcgcaaatatattcggtggtattaccgatactatggaa
attgcttcagcaatcatcgaatgtaaagggaagaacccggaaattcaaatcttcgcccga
ataacaggaaacaatgagatgttttccagaaaacttttaacagaaaatggaataaaggtt
ttcgacagcaccacagatcttataaacgctctaaggagggagagctatgttttgtaa

DBGET integrated database retrieval system