KEGG   Thermotoga lettingae: Tlet_1461Help
Entry
Tlet_1461         CDS       T00618                                 

Definition
(RefSeq) succinate--CoA ligase (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tle  Thermotoga lettingae
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlet_1461
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tlet_1461
   00640 Propanoate metabolism
    Tlet_1461
   00660 C5-Branched dibasic acid metabolism
    Tlet_1461
Enzymes [BR:tle01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tlet_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1532663..1533739
Genome map
AA seq 358 aa AA seqDB search
MYSSPIAEGYLGNFCLCGGEDMKIHEYVGKNVLKENGFNVPKSVLINGPFERRDLEQLDL
PHVLKAQVLVGGRMKAGGVVFSRSYEETYQKISYLLGRKIKGEKCTKVLVEEVFEHDREE
YLSILIDRDIRDITVLYSEFGGIDIEDVEKQKIVKIKMEDISKLPDHVRDITYKLVNLFI
EKDLTLLEINPIAFNNKDEYMMLDCVMHIDENALYRQNWCPQIPSFDPELQGDVGIIGCG
AGIVMATFDAVIECGLKPGAFCDLGGGAKKENALKVLNDLSKRNKKIVANIFGGITDTME
IASAIIECKGKNPEIQIFARITGNNEMFSRKLLTENGIKVFDSTTDLINALRRESYVL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgtattcttccccgatagctgagggctatttgggaaatttttgtttgtgtggaggtgag
gatatgaaaattcacgaatatgtcggaaaaaatgttctaaaagaaaacggatttaatgta
ccaaaatccgtattgatcaacgggccttttgaacgaagagatcttgaacaactcgatctt
ccacatgttttgaaagcccaggttctggttggagggagaatgaaagctggtggtgtggtt
ttctccagatcatacgaagaaacttaccagaaaatttcatatctacttggaagaaaaata
aaaggagaaaagtgtacaaaggtgctcgttgaggaagtttttgaacacgatagagaagaa
tatttatcaatattgattgatagagacattagagatataacagtactctattccgaattc
ggcgggattgatatagaagatgtggaaaagcaaaaaatagtcaaaattaagatggaagat
atcagtaaattaccagatcacgtacgtgatataacttataaactggtaaatctttttata
gaaaaagatttgacacttcttgaaattaatccgatcgctttcaacaacaaagatgaatat
atgatgctggattgtgttatgcatatcgatgaaaatgctctttatagacaaaattggtgt
ccacaaattcccagctttgatcctgaacttcaaggtgatgtgggaataattggttgtgga
gccggtattgtcatggcaactttcgatgcagttatcgaatgcggccttaaacccggcgct
ttctgcgatctcggcggcggagcaaaaaaagaaaatgcactgaaagtgttaaatgatcta
agtaaaagaaataaaaaaatagtcgcaaatatattcggtggtattaccgatactatggaa
attgcttcagcaatcatcgaatgtaaagggaagaacccggaaattcaaatcttcgcccga
ataacaggaaacaatgagatgttttccagaaaacttttaacagaaaatggaataaaggtt
ttcgacagcaccacagatcttataaacgctctaaggagggagagctatgttttgtaa

DBGET integrated database retrieval system