KEGG   Pseudothermotoga lettingae: Tlet_1477Help
Entry
Tlet_1477         CDS       T00618                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tle  Pseudothermotoga lettingae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1544490..1545503)
Genome map
AA seq 337 aa AA seqDB search
MNIKKLLVDLSQIDGPSGFEDPVLEYIEKQISPYVDRTFYNKIGTLIAEKKGEGKEKLGI
FAHVDEVGHVVTKIEEGGFARLETVGGVDPKVMFAQRVRIYTKKGIARGVVGVLPPHLQK
EEHRKRVPDFDKIFIDVSCSDLGKDVSVGDVGVIESTPVEIGGKICGKALDNRASCAALI
VAAELLNFIKNKADVYFIFSSQEEIGGPGAVSVAYQLELDKAIVLDVTHGEAKIPGFPQI
KLGNGPALGTGPVVDREFYAEVAELAQKNGVKFQIEPVPGRSGTDTDAVQLTRTGIRTML
VSIPLMYMHTPVEVVDPVDVQETARLIALCTAIKKEG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgaatatcaaaaagttgcttgtggacctttcacagattgatggcccatcaggttttgaa
gatcctgttctggaatacatagaaaagcaaatcagcccttatgtagacagaactttctat
aacaaaattggcactctgattgctgaaaagaaaggtgaaggaaaagaaaaattagggatt
tttgcacatgttgacgaagtaggtcatgttgtaacaaagattgaagaaggtggatttgcc
aggcttgaaactgtgggaggagtagacccaaaagtaatgtttgctcaaagggtcaggata
tataccaagaaaggtattgcaaggggcgttgtaggtgtcctgcctccacatttacaaaaa
gaagagcatagaaaacgtgtgccagattttgacaaaatttttattgacgtttcatgcagc
gatttaggaaaagacgtctctgttggagatgtgggcgtgattgaatctacacccgttgag
ataggtggaaaaatatgtggtaaagccctggacaacagagcaagttgtgcagcgcttatt
gttgcagcagaattgttgaattttataaagaataaggcggatgtttactttatcttctca
agtcaggaagaaataggtggaccgggagctgtatctgttgcttatcaattagaacttgat
aaggccatcgttttggatgtcactcacggcgaagcaaagattccgggttttccgcaaata
aaacttgggaatgggcctgctcttggtactggaccggttgtggacagagaattttatgcg
gaagtagccgaattagcacaaaaaaatggtgtgaaatttcagatagaaccagtcccagga
agatctggtacagatactgatgcagttcaattaactcgcaccggtattcgaacaatgctt
gtttcaataccattgatgtacatgcacacaccagttgaagttgttgatccagttgatgtt
caggaaacggcgaggcttatcgcattgtgtacggcaatcaaaaaggagggatag

DBGET integrated database retrieval system