KEGG   Pseudothermotoga lettingae: Tlet_1489Help
Entry
Tlet_1489         CDS       T00618                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00900  Terpenoid backbone biosynthesis
tle01100  Metabolic pathways
tle01110  Biosynthesis of secondary metabolites
tle01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tlet_1489
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Tlet_1489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABV34045
JGI: Tlet1489
UniProt: A8F7B1
Position
complement(1560668..1561495)
Genome map
AA seq 275 aa AA seqDB search
MVISDYFEIERAYAKLNLYLDVLSKRPDGYHNITGLFQTIDLHDELEISQIDKRGEVRIE
TNIEIQGTNLIEKAFRTVEKFYNVGFGIKVRLKKNIPMGSGLGGGSSDAAAVLRFLGRKL
KISIKDLLILAAEVGSDVPFLIVGGTAIVEGRGEKVTFLNPISDYRVDLFCPTISVSTKF
AYQMIHESTYAKKPDFALKLYEAYLKRDHNQIKALSYNVFQEIMTSKYPQIQDALDKAQR
CNPIVAMMTGSGSCIFAVQADKGKYRFIEDVFQHL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggtcatatctgactattttgagattgaaagagcttacgcaaagttaaatctttacttg
gacgtgctttccaaaagaccggatggctatcacaatataacaggtctttttcaaacaata
gatttgcatgatgaacttgaaattagccagatcgataaacgtggtgaagtgagaatagag
actaacatcgaaatacaaggaacaaatttgatagagaaagctttcagaacagttgagaag
ttttataatgtgggttttggaataaaagtgagactgaaaaaaaacatcccgatgggatct
gggcttggtggtggaagttctgatgcagcagctgttcttcggttcttaggaagaaaactt
aagatctccatcaaagacttgttgatacttgctgctgaagttggatctgatgtaccattt
ttgattgttggaggaacggcaatagttgaaggaagaggtgaaaaagttacctttctcaac
cctataagtgattacagagtagatctgttttgcccaacaatttctgtttctaccaagttt
gcttatcaaatgatacacgaatcgacgtacgcaaaaaaaccggactttgctttaaagctt
tatgaagcttatttgaaaagggaccataatcagataaaagcactttcttacaatgttttt
caagaaataatgacttctaaatatccacaaatacaggacgcgcttgataaagctcagagg
tgcaacccgattgttgccatgatgacaggtagtggctcatgtatttttgctgttcaagca
gataaaggaaaatataggttcattgaagatgtttttcagcacctataa

DBGET integrated database retrieval system