KEGG   Thermotoga lettingae: Tlet_1584Help
Entry
Tlet_1584         CDS       T00618                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
tle  Thermotoga lettingae
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tlet_1584
Enzymes [BR:tle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Tlet_1584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1658895..1661258
Genome map
AA seq 787 aa AA seqDB search
MVEKLVDFWKACCYISAGMIYLKDNPLLRTPLKSEHIKNRLLGHWGASPALSFVYVHANR
VINKYNLNAIFIAGPGHGAPGVIAPVYLEGTLSEYYPEFTQDEEGMKKLFKYFSFPGGFG
SHCTPELPGSIQEGGELGYSLSHAYGAIFDNPKLLAVTVIGDGEAETGPLAASWHSNKFL
NPARDGAVLPVLSLNGYKINNPTVLARIEEAELLNLFKGYGYDPIIVDGTDDYVESHQKM
AEAMDKSVERIINIWSDAKEKIQRPILPMIILRSPKGWTAPKIVKDHYIEGYWRSHQVPL
SDVKENTENLVILQQWLMSYEPNKLFDQSGKLRKDLLELIPPDNLKMSKNPISNGGLIRI
PLKLPQLKEFSIDPQQQKYHENTRPLGDYLRKIIDLNPNNFRVFGPDETKSNRLDAIFAH
GKAWNARIFPVDSDEGYLSAFGRVMEILSEHTIEGWLEGYLLTGRHGFLNTYEGFAPIIS
SMVNQFGKWIDISSDISWRMPVSSLNLLLTSVVWRQDHNGFTHQDPGFITSIVDKWPNVV
RVYFPPDANTLLATTWHCLQTTNRINIIVADKQKHPQYLNIDEAIKNVIKGIGIWNFASN
HPQEEPDVVVASCGDIPTKEAIAAVKIVKDFFPELRIRFVNVINLFALTPSGEHPDGLTD
REFDSYFTTDKPVIFNFHGYPWLIHRLTYRRKNHDNIHVRGYRENRKYGIDSTALSPFLK
GRGGITTPMQLSILNQTDRFSIAIDIIDRVERISQKAGYARDLIRNAQIEALQYAYEHGV
DKPDLCD
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaaacttgttgatttctggaaagcctgctgctatatttcagccggaatgatc
tatctcaaagacaaccccctactgagaactcccttgaagtctgaacatataaaaaacaga
ttgcttggccactggggtgcttcacccgccttgagtttcgtatatgttcatgctaacaga
gtgataaacaagtacaatctgaatgccatcttcattgctgggcccggccatggcgcgcct
ggtgtaatagcgcctgtatatcttgaagggacattgagtgaatactatccggaattcaca
caagacgaagaagggatgaaaaaactcttcaagtatttttcttttccaggtggttttggc
agccactgcacacctgagctacccggttcgatacaggaaggtggtgagcttggttattca
ctttctcatgcctatggtgcaattttcgacaatccaaaactcttagctgtaacggttatt
ggagatggcgaagcagaaactggccctcttgcggcatcgtggcattccaataaatttctc
aatccagcaagagatggtgcggttttaccagtactgtctttgaatggctataaaataaac
aacccaacagtactcgctcgaatagaagaagccgaactactcaatttgttcaaaggctat
ggctatgatccaatcattgttgatggaacagatgattatgttgagtcgcaccaaaaaatg
gctgaagcgatggataagagtgttgaaagaataatcaatatctggtctgatgccaaggaa
aaaattcaaaggccaattttacccatgataattttgagatctccaaaaggctggactgcc
cccaagatcgtcaaagaccattacatcgaaggatactggagatcacatcaggtaccactt
tctgatgtcaaagaaaacacagaaaacctcgtgattttgcaacaatggttgatgagctat
gaacccaataaactattcgatcaatctggaaaattgagaaaagatttacttgaactcatt
ccaccagataatctgaagatgagtaaaaatcccatctcaaacggtgggcttatcagaatt
ccattgaaattgccccagttaaaagagttctccatcgatccgcagcaacagaaataccac
gaaaacacccgcccgcttggagactatctcagaaagatcatagatcttaatccaaataat
ttcagagtttttggaccggatgaaacaaaatccaacagacttgatgcaatatttgctcat
ggcaaagcctggaatgcaagaatttttccagttgacagcgacgaaggctatctttcagcc
tttggaagggttatggaaattctctctgaacacacgatcgaaggttggcttgaaggctat
ttgctcacaggcaggcatggttttctaaatacttacgaaggttttgcacctattatttct
tcgatggtcaatcaatttggaaagtggatcgatatatcttcggatatttcctggagaatg
ccggtttcttctttaaatctgctgctgacttctgtggtatggcggcaggatcacaacggt
ttcacgcatcaagacccgggttttataacctcaattgttgacaaatggccaaacgtagtc
agagtttattttccaccagatgcaaatacacttctggcaacgacatggcactgtctgcag
acaacaaacaggataaacatcatcgtggccgataaacaaaaacatccacaatatctgaat
attgatgaagcaatcaaaaacgtgataaaaggaattggaatctggaattttgcatcaaat
catccacaagaagaaccagatgttgtcgtggcaagctgtggagatattccaacaaaggaa
gccatcgcggcagtgaagattgttaaagactttttcccggagctcagaataagatttgta
aacgtgataaatcttttcgctctaacaccgagcggtgagcatcctgatggattgactgat
agagaatttgattcttatttcaccactgacaaacctgttatattcaacttccacggttac
ccatggctcatacacaggctcacatacagaaggaaaaatcacgacaatattcatgtgcga
ggttatcgcgagaacagaaaatatggaatagattccaccgcactttcaccgttcttgaaa
ggaagaggtggtataaccacaccgatgcagctatcgattttgaatcaaactgacagattc
agtatagcaatagacataatagacagggtagaacgcataagccaaaaagccggttatgca
agagatctgataagaaacgctcaaattgaggctcttcaatatgcttatgaacatggagta
gataaaccagacctttgtgattaa

DBGET integrated database retrieval system