KEGG   Pseudothermotoga lettingae: Tlet_1628Help
Entry
Tlet_1628         CDS       T00618                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00230  Purine metabolism
tle01100  Metabolic pathways
Module
tle_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tlet_1628
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Tlet_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 ABC_tran AAA_16 AAA RsgA_GTPase MMR_HSR1 AAA_22 AAA_23 NTPase_1
Motif
Other DBs
NCBI-ProteinID: ABV34182
JGI: Tlet1628
UniProt: A8F7P8
Position
complement(1696544..1697170)
Genome map
AA seq 208 aa AA seqDB search
MKGVLYVVSGPSGVGKTSIIELTLKKVKNIVFSVSCTTRPKRPGEIDGKDYFFVSEPSFM
KMVENGEFLEWAVVHSYYYGTLKKFVEEQLENGKNVLLDIDVQGAMTVMKKAGDAVYIFI
APPSFEELKQRLVKRGTEDKTNLERRLEDAKRELSFIPQFEYLIVNENLQESVDQLCSII
VAEQVRVKRALDRLGMHKFFENGGGYVE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggagttctgtatgtcgtcagcggaccatcaggagtcggaaaaacctccattatc
gagttaactcttaaaaaagtaaaaaatatcgttttttctgtgtcctgtacaacaagacct
aaaaggcctggtgaaattgacggaaaagattacttttttgtcagtgagccttcatttatg
aaaatggtggagaatggtgagtttctcgagtgggctgttgtgcacagttactactatgga
acgttaaaaaaatttgttgaagaacaactcgaaaacgggaaaaatgttcttctggatata
gatgttcagggtgcaatgacggttatgaaaaaagccggggatgctgtgtatatattcatc
gctccaccttcttttgaagaattaaaacagaggcttgtaaagcgtggaacggaggataaa
actaatttggagcggagattggaagatgcaaaaagagagctgtcttttatcccgcaattc
gaatatttgatagtgaatgaaaatcttcaggaatcagttgatcaactttgctctataatt
gttgctgaacaggtaagagttaagagagctcttgacaggcttgggatgcacaaatttttt
gaaaatggaggtggctatgttgagtaa

DBGET integrated database retrieval system