KEGG   Thermotoga lettingae: Tlet_1691Help
Entry
Tlet_1691         CDS       T00618                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tle  Thermotoga lettingae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tlet_1691
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Tlet_1691
Enzymes [BR:tle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tlet_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1757066..1758574)
Genome map
AA seq 502 aa AA seqDB search
MSLESLAGELFMVGIDGTELTDEAARVLEQVKPGFIILFSRNIESPEQLYQLIKELRKVV
KKPVVFSIDQEGGIVTRLRNGFTVSCGAMALAATKDENNAYLAGKILALEMKSLGITWNL
APVLDINDNPNNPGIGVRSFGDTPQKVIKFAKAFYKGLSEESVAACGKHFPGKGSVEVDA
HLDMPVLQKSLEELKRWELIPFVELMKEGLESIMPSHIHLPQLQPDRLPATVSKEILTDL
LRKTLNYHGIAVADDLLMGGITKAMSVEDAVINSFKSGMDVLSLCHEPQAQISAKKALLE
QIKKNPELEKRLSESLGRIKNFKEKFYLKTLPDEISFDFSDHEKIMDKIAEQSITLVSDE
DKMIPLELSVNDCVITVKTSRLVQVQETQMGIPWVAKELSEKFGCELLVVDKDSKLAKKG
KKCVFFTENAHLSAWQSRLLEQARSNFRQLLVVAMRNPYDCFLVNSSSICSYSYEMVSQR
ALFKVLLGEIKPLGELPVEVFK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcttagaaagccttgctggggagctttttatggttggtatagatggtacggaatta
actgatgaggctgcgcgcgttcttgagcaggttaaacctggttttatcatacttttttca
agaaacattgaatctccggagcaactttaccagctgatcaaagagctcagaaaagttgtc
aaaaagcctgtagtcttttccatagatcaggaaggaggaattgtaacaaggcttagaaat
ggatttacagtgagttgtggagcgatggcccttgcggcgacgaaagatgaaaacaatgca
tatctcgctgggaagattctggctttggaaatgaaatctcttggaattacgtggaatctc
gccccggtgcttgatataaatgacaatccgaataacccgggaattggagtgagaagtttt
ggggacacaccgcaaaaagtgataaagttcgccaaggctttttacaaaggtttgagcgag
gaatcagtcgcagcctgcggtaagcattttcctggaaaagggagtgtggaagttgatgcg
cacttagatatgcctgttttgcaaaaatctcttgaagaactcaaaagatgggaattgata
ccctttgttgagcttatgaaagaaggtttagaaagtatcatgccgagccatatacatttg
ccacaattgcaaccagacaggctgccagctacggtttcaaaagaaatactcacagatctg
ctcagaaaaacgttgaactatcatggtatagctgtggctgatgatctgttgatgggtggt
ataacaaaagctatgtctgttgaagatgcggtgattaattccttcaaatcaggtatggat
gttttaagtttatgccatgaaccacaggctcaaatttctgccaaaaaagctttacttgag
cagataaagaaaaatcctgagcttgaaaaaagattatctgaatctcttggaagaattaaa
aattttaaagagaaattctatttaaaaacccttcccgatgaaatatcatttgatttttct
gatcatgaaaagatcatggacaaaatagcagaacaatctataactcttgtgagcgatgaa
gataagatgattcctcttgagttatctgtgaatgattgtgtgatcactgtgaaaacaagc
aggcttgttcaggttcaggaaactcaaatgggaattccatgggttgcgaaagaattgtca
gaaaaatttggttgtgaattgctggtggtggataaagattcaaaattagcaaaaaaaggt
aaaaaatgcgtttttttcacggaaaatgctcatctcagtgcctggcaaagtcgattactc
gaacaggcaagaagcaatttcagacagttacttgttgtggcaatgagaaatccgtatgat
tgttttcttgttaactcatcttctatatgttcttacagttatgaaatggtttcccaaagg
gcactttttaaggttttgctcggagagattaaaccccttggagaattaccagtggaggtg
ttcaaatga

DBGET integrated database retrieval system