KEGG   Pseudothermotoga lettingae: Tlet_1775Help
Entry
Tlet_1775         CDS       T00618                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00010  Glycolysis / Gluconeogenesis
tle00020  Citrate cycle (TCA cycle)
tle00620  Pyruvate metabolism
tle00640  Propanoate metabolism
tle00650  Butanoate metabolism
tle00680  Methane metabolism
tle01100  Metabolic pathways
tle01120  Microbial metabolism in diverse environments
tle01130  Biosynthesis of antibiotics
tle01200  Carbon metabolism
Module
tle_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_1775
   00020 Citrate cycle (TCA cycle)
    Tlet_1775
   00620 Pyruvate metabolism
    Tlet_1775
   00640 Propanoate metabolism
    Tlet_1775
   00650 Butanoate metabolism
    Tlet_1775
  Energy metabolism
   00680 Methane metabolism
    Tlet_1775
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tlet_1775
Enzymes [BR:tle01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tlet_1775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABV34329
JGI: Tlet1775
UniProt: A8F845
Position
complement(1845572..1846744)
Genome map
AA seq 390 aa AA seqDB search
MKLTRQAITGAQAAAYAMKQIEPDVVAAYPITPQTPIVEYFAKYVADGVVKTEMIPVESE
HSAMSALVGAAAAGARAMTATSANGLALMHEIVYIAASLRLPIVMPVVNRALSGPINIHC
DHSDTMAERDSGWIQLFCEDAQEVYDLTIMAVRIAEHENIRLPVMVNQDGFIISHGVEAV
ELLPDDVVKSFVGQLKPLYPLLDVENPVTYGPLDLYDYYFEHKRQQIEAMKNVFEVFSKI
SEEYYKISGRKYDYVEPYKMEDAQYVMVALGSTNGTIKYVVDQLREEGKKVGLLKIWMFR
PFPKAEIQRYLTGRKAVVVLDRSASFGAEAPLYEAVKSSLYEVASKPLLGSFVYGLGGRD
VNPELIRYAFEKAISHELVADQELYLGLRE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaccagacaggctataactggagcacaggcagccgcttatgctatgaaacag
attgaacctgatgtagtggctgcttatcctatcacccctcaaacacccatagttgaatat
tttgcaaaatatgttgccgatggtgtagttaaaacagaaatgatacctgttgagagcgag
catagtgcgatgagtgcacttgttggtgccgctgctgcaggcgcaagagcaatgacagca
accagtgccaatggacttgcactaatgcatgaaattgtttatatagctgcttcattgaga
cttcctatagtaatgccggttgtcaacagagcacttagtgggccaataaatatacattgt
gaccatagtgatacaatggcagaaagagattcaggatggatacagcttttctgcgaagac
gcgcaggaagtttacgatttgacaatcatggctgtaaggattgccgaacatgaaaatata
agactgcctgttatggttaatcaggatggattcatcatttctcatggagtagaagcggtt
gaattgttgcctgacgatgttgtcaagagtttcgttggtcagttgaagcctctctatcct
ctccttgatgtggaaaatccagtgacatacggtcctcttgatctatacgactattatttc
gaacacaaaaggcagcaaattgaggcaatgaaaaatgtttttgaggtattctcaaaaata
tctgaagagtattacaaaatttctggcaggaaatatgattatgttgaaccttacaaaatg
gaagacgcacagtatgttatggtagctcttggttcaactaatgggacgataaaatatgtt
gttgatcaattaagagaagaaggaaaaaaagttgggttgttaaaaatatggatgttcaga
ccattcccgaaagctgaaatacagaggtaccttacaggtagaaaagccgttgtcgttctc
gatagatcggcttcttttggtgcagaagcacctctatatgaggctgttaagtcgtctctg
tatgaagtagcatcgaagccgcttcttggttcctttgtctatggacttggcggcagagat
gttaatccagaattgataaggtacgcttttgaaaaggctatcagtcatgaacttgttgca
gaccaggaattgtaccttggtctgagagaatga

DBGET integrated database retrieval system