KEGG   Pseudothermotoga lettingae: Tlet_1776Help
Entry
Tlet_1776         CDS       T00618                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle00010  Glycolysis / Gluconeogenesis
tle00020  Citrate cycle (TCA cycle)
tle00620  Pyruvate metabolism
tle00640  Propanoate metabolism
tle00650  Butanoate metabolism
tle00680  Methane metabolism
tle01100  Metabolic pathways
tle01120  Microbial metabolism in diverse environments
tle01130  Biosynthesis of antibiotics
tle01200  Carbon metabolism
Module
tle_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_1776
   00020 Citrate cycle (TCA cycle)
    Tlet_1776
   00620 Pyruvate metabolism
    Tlet_1776
   00640 Propanoate metabolism
    Tlet_1776
   00650 Butanoate metabolism
    Tlet_1776
  Energy metabolism
   00680 Methane metabolism
    Tlet_1776
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tlet_1776
Enzymes [BR:tle01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tlet_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_7 Fer4_16 Fer4_6 Fer4_9 Fer4_10 Fer4_2 Fer4_13 Fer4_17 Fer4_8 TMC Fer4_4 Fer4_15 Fer4_3 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ABV34330
JGI: Tlet1776
UniProt: A8F846
Position
complement(1846747..1847049)
Genome map
AA seq 100 aa AA seqDB search
MAELKKWNEVPIGGIITEPGTARKYKTGDWRVKRPVYDRSKCIDCMMCWFYCPDLAIIQE
NSVMKGINYFYCKGCGICANVCPRNAIEMRPETEFSHEEE
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttgaagaaatggaatgaagttccaattggtggaattattactgagccggga
actgcacgcaaatacaaaaccggcgactggcgcgtgaaaagacctgtttatgatagatca
aaatgtatagattgtatgatgtgttggttctactgtccggaccttgctattattcaggaa
aattctgttatgaaagggataaattatttctattgtaaaggctgtggtatttgcgctaat
gtttgcccaagaaatgctattgagatgagacccgaaacagagttttcacacgaggaggag
tga

DBGET integrated database retrieval system