KEGG   Thermotoga lettingae: Tlet_1810Help
Entry
Tlet_1810         CDS       T00618                                 

Definition
alpha/beta hydrolase domain-containing protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tle  Thermotoga lettingae
Brite
Enzymes [BR:tle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Tlet_1810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1880695..1881462
Genome map
AA seq 255 aa AA seqDB search
MKLNIYDQDIRLIDPICFPIFKTNGKKGVLLIHGFTGSPHDMIYVAQRLFDEGFTVSVPR
LPGHGTSHRDFLNSTWKDWVRRSIDAYLDLTNFCDEISVVGLSMGALLAAVVASRFKIRK
VVLAAPAFKVTDWRLKFTPLMSLFVHYKEKEPPVFDDPSLNKLAQEYWNKVFIKPAAHLY
KLQKVAIKSLEMVESPTLVIVTQKDNSVPLSVLDVIKDHLKAEFKTVVLEKSAHPVTNDV
EKELVAEKIAEFLSN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaatatatatgaccaggatattcgcttgattgatcctatatgttttccgatc
ttcaaaacaaatggcaaaaaaggtgtacttttaattcatggtttcacaggaagtccacac
gatatgatttacgttgcacaaagacttttcgatgaaggctttactgtatctgttccgcgg
cttcccggacatggcaccagccacagagattttctgaattcaacctggaaagactgggtt
agaaggtcaatagacgcctatctcgatttaaccaatttttgcgacgaaataagcgttgtt
ggcctttcaatgggagcacttcttgctgctgttgtagcatcgagatttaaaatcaggaaa
gttgtcctggcagcccctgctttcaaggtaacagattggagactgaaattcacccccttg
atgagtttatttgtgcattacaaagaaaaagaaccaccagtttttgatgacccttcactc
aacaaattagcccaagaatattggaataaagtatttataaaacctgctgcgcatttgtat
aagctacaaaaggttgccataaaaagtctcgagatggttgaatctcctacattagtcata
gtaacccaaaaagacaactctgtaccgttatctgttttagatgttataaaagatcatttg
aaagctgaattcaagactgttgttcttgaaaaaagcgctcatcctgtgacaaatgatgta
gaaaaagaacttgttgctgaaaagatagcagaatttctttctaactaa

DBGET integrated database retrieval system