KEGG   Thermotoga lettingae: Tlet_1871Help
Entry
Tlet_1871         CDS       T00618                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tle  Thermotoga lettingae
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Tlet_1871
Enzymes [BR:tle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Tlet_1871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1942157..1942816
Genome map
AA seq 219 aa AA seqDB search
MYEQQKRLIVEFGLKMLRSNHVSGSSGNISVKIDENLIAITPSGIAYDKLNFDQVPVIDM
NGKIIEGNLKPSIEYQLHTQIYRNFSDVNAVIHTHSIYATVLSVLRIPLPAITETVLMFS
KQIPVSEYANAGTNELARNVVRCMKDSRAVLIANHGLVCAAKSLDEAFNMCEAVERSAQV
YVSAMSTNMPIYVIDEKYAEEAMTFLKKNYGQATDFISF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagcagcaaaaaagattaatagttgaatttggattaaaaatgcttagatcaaac
catgtgagtggaagttcgggaaacataagcgtgaaaatagatgaaaatctcatagcaatt
actccgagtggcatcgcctacgataaactcaattttgatcaggtgcctgttatagatatg
aatggaaaaataattgaagggaatctcaaaccatctattgagtatcagcttcacacacag
atatacagaaatttttctgatgtgaacgctgttattcatacacattcaatttacgcaaca
gtactttctgtgcttcgaattccattaccagcaataacagaaactgttttgatgttttca
aagcagattcccgtgagtgaatatgcaaatgctggaacaaatgagcttgccagaaatgta
gttcgttgcatgaaagacagcagggcggtgttaatagcaaatcatggccttgtgtgtgcc
gcaaaatcattagacgaagctttcaatatgtgcgaagctgttgaaagaagtgcccaggta
tacgtatctgccatgtcaacaaacatgccgatttacgtcatcgacgaaaaatatgcagaa
gaagctatgacgtttttgaagaaaaattatggacaggcaactgattttatctctttttag

DBGET integrated database retrieval system