KEGG   Pseudothermotoga lettingae: Tlet_1887Help
Entry
Tlet_1887         CDS       T00618                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tle  Pseudothermotoga lettingae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tlet_1887
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tlet_1887
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tlet_1887
Enzymes [BR:tle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tlet_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1959237..1960505)
Genome map
AA seq 422 aa AA seqDB search
MRIRVDLKVDEIPRYWYNVLSDLPFKLDPPLDPKTKQPISPDMLSAIFPMPLIEQEVTDK
REIPIPEPVLEEYAVFRPTPLFRATYLEEFLQTPARIYYKYEGASPTGSHKTNTALAQAY
YNKISGTERLVTETGAGQWGSALCYSGAKFGLKVNVFMVKISYEQKPMRKYLMRLFDGDV
VPSPSEKTSFGKSILASNSENPGSLGIAISEAIEITLSDSRTKYSLGSVLNHVLLHQTVI
GLELKKQLEVLGEKPDVILGCHGGGSNFGGTVLPFIPDKLSGKEIKFVACEPTACPSLTR
GRYDYDYGDTAGMTPLLKMYTLGKDFIPPKIHAGGLRYHGAAPIISRLVKEGLIEAVAFD
QDEIFSAAKLFAKLEGIVPAPESSYAIAGAIREAKKAKEHNIPRVVVFNLSGHGLFDLTA
YI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcagggtggatttgaaagttgatgagattccaaggtactggtacaatgtgctg
tctgatttgccttttaaactcgatcccccattggatccaaaaacaaaacagcccatatca
ccggatatgctttctgctatttttccaatgccgttgattgagcaagaagtcactgacaaa
cgtgaaattccaataccagaaccagttcttgaagaatatgctgtttttagaccaacgcct
ttgtttagggcaacctacctcgaggagtttttacagacgccagcaagaatttactacaag
tatgaaggtgcaagtccaactggaagtcataaaacaaacacagcccttgcccaggcttat
tacaacaaaatctcaggcacagaaaggcttgttactgagacaggtgcagggcaatggggg
agcgcgctttgttactcaggtgcaaagtttggactgaaagtgaatgttttcatggtaaag
atcagttatgaacaaaaacccatgagaaagtatttgatgagactttttgatggtgatgtt
gttccaagtccaagcgagaaaaccagttttggtaaatcaattcttgcaagcaacagcgag
aaccctggaagccttgggattgcaataagtgaagctattgagataactctatcggattcc
agaaccaaatattcacttggcagtgttttaaatcatgttttgcttcaccagacggtgata
ggtcttgagttgaaaaagcaacttgaggtgcttggtgagaagccagacgtgatacttgga
tgccatggaggcggttcaaattttggtggaactgttttgccgtttattccagacaaactt
tcaggaaaagaaatcaaatttgtcgcgtgcgaaccaacggcatgtccctctcttaccagg
ggtagatatgattacgattatggtgatacagcaggcatgacaccacttttgaaaatgtac
acacttggaaaagatttcatacctccaaagattcatgcaggtggtttgcgttatcacggt
gcagccccaattatttcaagacttgtgaaagaaggtcttattgaagctgttgcgttcgac
caggatgaaattttttcggcggcgaagctttttgctaaacttgaaggaatagtccctgct
ccggaaagttcgtatgcgatagctggtgctataagagaagcaaaaaaagcaaaagagcac
aatattccgagagttgttgtttttaatctcagtggacatgggttatttgacctgactgct
tatatataa

DBGET integrated database retrieval system