KEGG   Thermotoga lettingae: Tlet_1887Help
Entry
Tlet_1887         CDS       T00618                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tle  Thermotoga lettingae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tlet_1887
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tlet_1887
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tlet_1887
Enzymes [BR:tle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tlet_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1959237..1960505)
Genome map
AA seq 422 aa AA seqDB search
MRIRVDLKVDEIPRYWYNVLSDLPFKLDPPLDPKTKQPISPDMLSAIFPMPLIEQEVTDK
REIPIPEPVLEEYAVFRPTPLFRATYLEEFLQTPARIYYKYEGASPTGSHKTNTALAQAY
YNKISGTERLVTETGAGQWGSALCYSGAKFGLKVNVFMVKISYEQKPMRKYLMRLFDGDV
VPSPSEKTSFGKSILASNSENPGSLGIAISEAIEITLSDSRTKYSLGSVLNHVLLHQTVI
GLELKKQLEVLGEKPDVILGCHGGGSNFGGTVLPFIPDKLSGKEIKFVACEPTACPSLTR
GRYDYDYGDTAGMTPLLKMYTLGKDFIPPKIHAGGLRYHGAAPIISRLVKEGLIEAVAFD
QDEIFSAAKLFAKLEGIVPAPESSYAIAGAIREAKKAKEHNIPRVVVFNLSGHGLFDLTA
YI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcagggtggatttgaaagttgatgagattccaaggtactggtacaatgtgctg
tctgatttgccttttaaactcgatcccccattggatccaaaaacaaaacagcccatatca
ccggatatgctttctgctatttttccaatgccgttgattgagcaagaagtcactgacaaa
cgtgaaattccaataccagaaccagttcttgaagaatatgctgtttttagaccaacgcct
ttgtttagggcaacctacctcgaggagtttttacagacgccagcaagaatttactacaag
tatgaaggtgcaagtccaactggaagtcataaaacaaacacagcccttgcccaggcttat
tacaacaaaatctcaggcacagaaaggcttgttactgagacaggtgcagggcaatggggg
agcgcgctttgttactcaggtgcaaagtttggactgaaagtgaatgttttcatggtaaag
atcagttatgaacaaaaacccatgagaaagtatttgatgagactttttgatggtgatgtt
gttccaagtccaagcgagaaaaccagttttggtaaatcaattcttgcaagcaacagcgag
aaccctggaagccttgggattgcaataagtgaagctattgagataactctatcggattcc
agaaccaaatattcacttggcagtgttttaaatcatgttttgcttcaccagacggtgata
ggtcttgagttgaaaaagcaacttgaggtgcttggtgagaagccagacgtgatacttgga
tgccatggaggcggttcaaattttggtggaactgttttgccgtttattccagacaaactt
tcaggaaaagaaatcaaatttgtcgcgtgcgaaccaacggcatgtccctctcttaccagg
ggtagatatgattacgattatggtgatacagcaggcatgacaccacttttgaaaatgtac
acacttggaaaagatttcatacctccaaagattcatgcaggtggtttgcgttatcacggt
gcagccccaattatttcaagacttgtgaaagaaggtcttattgaagctgttgcgttcgac
caggatgaaattttttcggcggcgaagctttttgctaaacttgaaggaatagtccctgct
ccggaaagttcgtatgcgatagctggtgctataagagaagcaaaaaaagcaaaagagcac
aatattccgagagttgttgtttttaatctcagtggacatgggttatttgacctgactgct
tatatataa

DBGET integrated database retrieval system