KEGG   Thermotoga lettingae: Tlet_1905Help
Entry
Tlet_1905         CDS       T00618                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tle  Thermotoga lettingae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tlet_1905
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tlet_1905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1978305..1979231)
Genome map
AA seq 308 aa AA seqDB search
MIAVIGSNNVDLVLTVDHFTNPGETQSCISFERFSGGKGANQAIACKKLGATVRFLTCVG
DDENGQFILQNFSENGIAEFAVKVRSPNGFAMIEVTKTGENRIIIYAGANGFLTPETVRE
NAPDLLEASVLLLQNEIPFQTSFEAAKLFKANGKMVIFDPAPAHGIDSSIFKFVDIITPN
ESELIALTQISSVREAIDRLLKSGCKNVLLKMGEKGCIFKGEYGEFYVESFKVNAVDTTA
AGDIFNAAFAVGFCRFGDIYRALVFASASAAISVTRKGAQSSIPFYEEVAGFLNARGGNN
FTKTDEIL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcggttattggaagtaacaacgttgaccttgttttaacagtagaccatttcaca
aatccgggagaaacgcagagttgtatttctttcgagagattttctgggggtaaaggggca
aatcaggcaattgcgtgcaaaaaattgggagcgactgttagatttctgacatgcgtgggc
gatgatgaaaatggacaatttattttgcaaaatttttcagaaaatggtattgctgagttt
gcggtaaaagttcgctcgccaaatggttttgcgatgatagaggttacaaagactggtgaa
aatcgaataataatttacgctggtgccaatggttttctgacgccagagactgtaagagaa
aacgcgccagatcttcttgaggcgagtgtgcttttgttgcaaaatgagattcctttccag
acgagtttcgaagcagcaaaactttttaaagcaaatggcaagatggtgatttttgatcca
gcaccggctcatggtatagatagttcaattttcaaatttgttgatattattactccaaac
gaatccgaactgatcgctttaacacagatatccagtgtgagagaagcaattgacaggctt
ctcaaaagcggctgtaaaaatgtgcttttaaagatgggggaaaagggatgtattttcaaa
ggtgaatatggtgaattttacgttgaatcttttaaagtcaatgctgttgacacaactgct
gctggtgatatttttaatgctgcttttgcagtaggattttgccgatttggggatatctac
agagctctggtttttgcgtctgcttcggcagcgataagcgttacacgcaagggtgcacag
agttctattccattttacgaggaggtagctggatttctcaatgcaagaggggggaataat
tttacaaagacagatgagattttataa

DBGET integrated database retrieval system