KEGG   Thermotoga lettingae: Tlet_1946Help
Entry
Tlet_1946         CDS       T00618                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tle  Thermotoga lettingae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlet_1946
   01230 Biosynthesis of amino acids
    Tlet_1946
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_1946
   00030 Pentose phosphate pathway
    Tlet_1946
   00051 Fructose and mannose metabolism
    Tlet_1946
   00052 Galactose metabolism
    Tlet_1946
  Energy metabolism
   00680 Methane metabolism
    Tlet_1946
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tlet_1946
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tlet_1946
Protein phosphatases and associated proteins [BR:tle01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tlet_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2021387..2022397)
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLCVGNDCPGLNAAIRAATVKASELNIEILGVKDGFEGFLSGKIEVMTRNTVSGI
LHKGGTILGTSLFLPVNEEDIVQVAEKVEQYSITCLLILGGRLGVRAALKLMQSGVPSVL
VPATIDNDLSFSDFSIGFFTAVEHVKDALDILHATAESHHRVMIVETMGKPGGWIAVVGG
LAGGADYIITSAEPLDIQELLKKIRSRYESQKRFSLVIVENDVNLPGEIYQLANMDSHIP
PAEAIGEFLEKQLKDINMEWRYTNLGYLQRGGSPVSMDRLIAIQMATRAVEMVKAARVYH
AVGMKGLTVTEVPYSDTMINVRTVEEHLKNLAKLFY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagctgttctttgcgtcggaaatgattgcccgggattgaatgcagctatc
agagcagcaactgttaaagcttcagagctaaatatagagattcttggtgttaaggatggt
tttgagggattcctgagcggaaaaatagaagttatgacaagaaacaccgtttctggaata
ttgcataaaggaggaaccattcttggaacctctctgtttttacctgtgaatgaagaagac
attgtgcaggtagcagaaaaggttgaacagtattctataacatgtttactgatacttggt
ggaagacttggagtgagagccgcattgaaactgatgcagagtggtgttccatctgttctt
gttccggcaaccatcgacaacgatctttcctttagtgacttttccataggattttttacg
gctgttgaacacgttaaagatgcccttgatattttgcacgcgacggcggaatcacatcac
agagtaatgattgttgaaacgatgggtaaaccaggtggctggatagcagtagttggaggt
cttgcaggaggggctgattatataataaccagtgccgagcctcttgatatccaagaactt
ttgaagaagattcgcagccgttatgaaagtcaaaaaaggttttctctcgttattgtagag
aacgatgtcaaccttccgggtgaaatataccagcttgctaatatggattctcacatacct
ccagcagaagccataggtgagtttctcgaaaaacaattgaaagatataaacatggaatgg
agatatacaaatctcggatatttacaaagaggaggcagtcctgtgtctatggatagatta
atagcaattcagatggcgacgagagcagtagaaatggttaaggcggcaagagtgtaccat
gctgttggtatgaagggattgacagtgacagaggtgccatattcagatactatgattaat
gtacgaactgtcgaggaacatctgaaaaatcttgcaaaacttttttattga

DBGET integrated database retrieval system