KEGG   Thermotoga lettingae: Tlet_1950Help
Entry
Tlet_1950         CDS       T00618                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tle  Thermotoga lettingae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tle01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tle01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tle00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tle00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tle00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tle00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:tle00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2026225..2027487
Genome map
AA seq 420 aa AA seqDB search
MSGKVGILVGGGPAPGINSVINAVTIEAINNGLEVVGIYDGFEHLMKAQTTFVRHLTISD
VSRIHIEGGSILRTSRANPTKKAEDLQNVVRALKELQVRYLVTIGGDDTAFSASSVMKVS
NGALRVAHVPKTIDNDLPLPGGMPTFGFETARHVGTELVYNLMQDSRTTNRWYFVVVMGR
KAGHLALGIGKAASAALTVIGEEFRKERIKLSEVCDLLEAAIIKRKALGRNDGLAVIAEG
IGEMIDPKELASIPGVVVETDPHGHIRLSEIPLATILKREIQKRFAQRDEKINIIDVTLG
YELRCARPTPFDIDYTRTLGYGAMRFLLGEYEENLTGGMVCLDNGRIRILPFEELIDPST
GRTKVRMVDINSEHYRVARSYMIRLTRKDLQDEEMLSRLTRVARISREEFLEKFSKVAEI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgggaaagtcggaattctcgttggtggaggtcccgcaccaggcatcaatagcgtg
atcaacgccgtgacaattgaagccattaacaatggcttggaggtagtgggtatttacgac
ggtttcgagcacctgatgaaagcacaaacgacctttgtccgccatttaactatttcagat
gtctctcgcattcacattgaaggaggttctatcttaagaacatcgcgcgcaaatcccaca
aaaaaagctgaggatctgcaaaatgtcgttagagctcttaaagaactgcaggtgaggtac
ctggtcacaataggtggggatgataccgcattttcagcttcatcagtgatgaaagtgagc
aatggagcactacgtgttgcacatgttccgaaaactatcgataacgatctaccactccct
ggaggcatgccaactttcggttttgaaacagcacgccatgttggaacagaacttgtctat
aacttgatgcaggattcaagaactacaaacagatggtatttcgtcgtagtaatgggaaga
aaagcaggtcatttagcgctcggtataggtaaagcagcaagcgcagcattaaccgttatt
ggagaagaattcagaaaggaaaggataaaactttctgaagtatgtgatctgcttgaggca
gctataataaaaagaaaagcactggggcgtaacgatggtttagcagtaatagctgaagga
ataggagaaatgatcgatccgaaagaacttgcaagtattcccggcgtagtagttgaaact
gatccgcatggtcatataagactgagcgaaattcctcttgcaactattctcaaaagggaa
attcagaaacgtttcgctcagagagatgaaaagataaatataatcgacgtgacacttgga
tatgaactcagatgtgcaaggccaacacccttcgatattgattacacaagaaccttaggt
tacggagcaatgcgatttttacttggagaatatgaagaaaatttgactggtggtatggtg
tgccttgacaatggaagaattagaatactgcctttcgaagaacttatagatccatccacc
ggtaggacaaaagtccgtatggtagatataaattctgagcactatagagttgcacgcagc
tacatgatcagattaaccagaaaagatttacaagatgaagaaatgctgtccagactaacc
agagtcgccagaataagcagagaagaatttcttgaaaaattctcaaaggtcgccgagata
tga

DBGET integrated database retrieval system