KEGG   Pseudothermotoga lettingae: Tlet_1950Help
Entry
Tlet_1950         CDS       T00618                                 

Definition
(GenBank) Diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tle  Pseudothermotoga lettingae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlet_1950
   00030 Pentose phosphate pathway
    Tlet_1950
   00051 Fructose and mannose metabolism
    Tlet_1950
   00052 Galactose metabolism
    Tlet_1950
  Energy metabolism
   00680 Methane metabolism
    Tlet_1950
Enzymes [BR:tle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tlet_1950
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Tlet_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2026225..2027487
Genome map
AA seq 420 aa AA seqDB search
MSGKVGILVGGGPAPGINSVINAVTIEAINNGLEVVGIYDGFEHLMKAQTTFVRHLTISD
VSRIHIEGGSILRTSRANPTKKAEDLQNVVRALKELQVRYLVTIGGDDTAFSASSVMKVS
NGALRVAHVPKTIDNDLPLPGGMPTFGFETARHVGTELVYNLMQDSRTTNRWYFVVVMGR
KAGHLALGIGKAASAALTVIGEEFRKERIKLSEVCDLLEAAIIKRKALGRNDGLAVIAEG
IGEMIDPKELASIPGVVVETDPHGHIRLSEIPLATILKREIQKRFAQRDEKINIIDVTLG
YELRCARPTPFDIDYTRTLGYGAMRFLLGEYEENLTGGMVCLDNGRIRILPFEELIDPST
GRTKVRMVDINSEHYRVARSYMIRLTRKDLQDEEMLSRLTRVARISREEFLEKFSKVAEI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgggaaagtcggaattctcgttggtggaggtcccgcaccaggcatcaatagcgtg
atcaacgccgtgacaattgaagccattaacaatggcttggaggtagtgggtatttacgac
ggtttcgagcacctgatgaaagcacaaacgacctttgtccgccatttaactatttcagat
gtctctcgcattcacattgaaggaggttctatcttaagaacatcgcgcgcaaatcccaca
aaaaaagctgaggatctgcaaaatgtcgttagagctcttaaagaactgcaggtgaggtac
ctggtcacaataggtggggatgataccgcattttcagcttcatcagtgatgaaagtgagc
aatggagcactacgtgttgcacatgttccgaaaactatcgataacgatctaccactccct
ggaggcatgccaactttcggttttgaaacagcacgccatgttggaacagaacttgtctat
aacttgatgcaggattcaagaactacaaacagatggtatttcgtcgtagtaatgggaaga
aaagcaggtcatttagcgctcggtataggtaaagcagcaagcgcagcattaaccgttatt
ggagaagaattcagaaaggaaaggataaaactttctgaagtatgtgatctgcttgaggca
gctataataaaaagaaaagcactggggcgtaacgatggtttagcagtaatagctgaagga
ataggagaaatgatcgatccgaaagaacttgcaagtattcccggcgtagtagttgaaact
gatccgcatggtcatataagactgagcgaaattcctcttgcaactattctcaaaagggaa
attcagaaacgtttcgctcagagagatgaaaagataaatataatcgacgtgacacttgga
tatgaactcagatgtgcaaggccaacacccttcgatattgattacacaagaaccttaggt
tacggagcaatgcgatttttacttggagaatatgaagaaaatttgactggtggtatggtg
tgccttgacaatggaagaattagaatactgcctttcgaagaacttatagatccatccacc
ggtaggacaaaagtccgtatggtagatataaattctgagcactatagagttgcacgcagc
tacatgatcagattaaccagaaaagatttacaagatgaagaaatgctgtccagactaacc
agagtcgccagaataagcagagaagaatttcttgaaaaattctcaaaggtcgccgagata
tga

DBGET integrated database retrieval system