KEGG   Thermotoga lettingae: Tlet_1985Help
Entry
Tlet_1985         CDS       T00618                                 

Definition
RuvA domain-containing protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tle  Thermotoga lettingae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tle03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2058090..2058650
Genome map
AA seq 186 aa AA seqDB search
MGVKGTVHSKNGSSVILEINGFLIKILCDIETLEKAQIGQTVQLHTHLEFSQEGITIYGF
LSKERLYVFEKILKVSKIGPKTALRIVSTSEPEELVHLIISQDVEKLSRFPGIGKKTAER
LIAELKDEEFEIKSDYSKELSDAIDALVALGFGKIESREAAKSVYHSSKKAEQIVKEALK
MLSKKV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgggagttaaaggcacagttcatagtaaaaatggtagcagtgtaatacttgaaatcaat
ggttttttgataaaaattctctgtgacattgaaacacttgaaaaagcacagatagggcag
acagttcagttgcatacacatcttgaattcagccaggaaggaataacaatttatggtttt
ctgagcaaagaaagactctatgtttttgaaaaaattctgaaagtctcaaaaataggtcca
aaaactgctttgagaattgtttcaacctctgaaccagaagaattagtgcatttgataatt
tctcaggatgtcgaaaaactatccagatttccaggtatcggtaaaaaaacagccgagagg
cttatagcggaattaaaagacgaagaatttgaaataaaatctgattattcaaaagagttg
tcagatgcaatcgatgcacttgtcgccctcggatttggtaagatagaatcaagagaggct
gcaaagagcgtctaccattcttcgaagaaggcagaacaaatagtcaaagaagcccttaaa
atgctttctaagaaggtgtga

DBGET integrated database retrieval system