KEGG   Pseudothermotoga lettingae: Tlet_1985Help
Entry
Tlet_1985         CDS       T00618                                 

Definition
(GenBank) RuvA domain protein
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tle  Pseudothermotoga lettingae
Pathway
tle03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tle00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tlet_1985
Enzymes [BR:tle01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tlet_1985
DNA repair and recombination proteins [BR:tle03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Tlet_1985
    RecFOR pathway proteins
     Tlet_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N RuvA_C HHH HHH_3 HHH_8 IMS_HHH 5_3_exonuc Transposase_20 EF_assoc_2
Motif
Other DBs
NCBI-ProteinID: ABV34539
JGI: Tlet1985
UniProt: A8F8Q5
Position
2058090..2058650
Genome map
AA seq 186 aa AA seqDB search
MGVKGTVHSKNGSSVILEINGFLIKILCDIETLEKAQIGQTVQLHTHLEFSQEGITIYGF
LSKERLYVFEKILKVSKIGPKTALRIVSTSEPEELVHLIISQDVEKLSRFPGIGKKTAER
LIAELKDEEFEIKSDYSKELSDAIDALVALGFGKIESREAAKSVYHSSKKAEQIVKEALK
MLSKKV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgggagttaaaggcacagttcatagtaaaaatggtagcagtgtaatacttgaaatcaat
ggttttttgataaaaattctctgtgacattgaaacacttgaaaaagcacagatagggcag
acagttcagttgcatacacatcttgaattcagccaggaaggaataacaatttatggtttt
ctgagcaaagaaagactctatgtttttgaaaaaattctgaaagtctcaaaaataggtcca
aaaactgctttgagaattgtttcaacctctgaaccagaagaattagtgcatttgataatt
tctcaggatgtcgaaaaactatccagatttccaggtatcggtaaaaaaacagccgagagg
cttatagcggaattaaaagacgaagaatttgaaataaaatctgattattcaaaagagttg
tcagatgcaatcgatgcacttgtcgccctcggatttggtaagatagaatcaagagaggct
gcaaagagcgtctaccattcttcgaagaaggcagaacaaatagtcaaagaagcccttaaa
atgctttctaagaaggtgtga

DBGET integrated database retrieval system