KEGG   Thermovirga lienii: Tlie_0012Help
Entry
Tlie_0012         CDS       T01644                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tli  Thermovirga lienii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tli01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tli00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(14104..15963)
Genome map
AA seq 619 aa AA seqDB search
MSFGKAKRAWINLKSKEVSMEHLDEKYTRKWGGMRGLALPIMLKEIEKDTDPLGPLNLLI
VAAGLLNGLGFHGTCRYGIYAKSPLTGGFGGSDAGGYFGPALRAQGVDALVFKERAEKPV
YIWIEDEKVEIKDATDLWGLETGPALEKLREKHGKVTAILIGPAGENQVRFACVINDLHH
VNGRTGMGAVMGSKNIKAIVAPYPKAIPPKDPVLHQEMIKVFSNWKDDPLSFGLHVHGTA
GGVTRLNQDGILPTMNFQQGTFEGASSIDGKLMTETLLKERLGCFACAVRCKRVVGGGKY
DTDPNYGGPEYETMAALGSLCGVDDLDAVTKGHELCNRFGLDTISAGMTIAWLMECVEKG
IMTKDEAIVSGFGDAQGMLKLLEKIARREGIGDLLAEGSKRASAKVGKGSEKFLMTVKGQ
ELPMHEPRGKKGVAIGYALSPTGADHMQFAHDPLFASPDSRPMKDIMALGILEPLPVTYL
GPEKIRAITYLWYFWAAFNHLGCCYFVFSPRSYFPIHRLHSLVEAATGWNITLWELMKMG
ERGLNAARLFNLKMGLTSGDDVIPERLHTPLPDGAFKGSTIGKDEFKDAVALCYSMMGWD
GQGIPKREKLAELGLEEFI
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttggcaaggcaaaaagggcatggataaacttgaaaagcaaagaggtctcaatg
gaacacctcgatgaaaaatacacaaggaaatggggtggtatgagaggccttgcattgccc
ataatgctaaaggaaattgaaaaggatacagatcctctgggacctcttaaccttttgata
gtagcagcaggattgttgaatggcctaggtttccatggtacttgccgctatgggatttac
gccaaaagcccccttacaggagggtttggaggaagcgacgcaggtggctactttggacca
gccctcagggcccagggtgtggatgctctggtgttcaaagaaagggccgaaaaacccgtc
tacatctggattgaagatgaaaaggtggaaatcaaagacgcaacggatctatggggtctt
gagacaggcccagcactggagaaattgagggaaaaacacggcaaggtaacagccatactc
ataggccctgcaggagaaaaccaggttcgatttgcctgcgtcataaacgacttgcaccat
gtaaacggacgcactggcatgggagctgtgatgggatccaagaatataaaggccatagtt
gctccatatccaaaggccatacctccgaaagaccctgtccttcaccaggagatgataaaa
gtgttctccaactggaaggatgaccctctatccttcgggctgcacgttcacggtactgca
ggaggagtcaccaggctcaaccaggatgggatcctgcctacgatgaactttcaacaggga
accttcgaaggggcatcctccatcgacggaaagttaatgactgaaaccctcctaaaggaa
cgcttggggtgcttcgcctgcgctgtgcgctgcaaacgagtggtcggaggaggcaagtac
gatactgaccccaactacggcggccctgagtacgagaccatggcggccttgggttccctg
tgcggtgtagatgatctggacgcagtaaccaaggggcacgagctctgtaacaggtttgga
cttgatactatttcagcaggtatgacgatagcgtggctaatggaatgtgtagaaaaaggg
ataatgacaaaagacgaagctatcgtttccggcttcggagacgctcaaggcatgctcaaa
ctactggagaaaatagcccgaagggaaggtataggagaccttttggccgagggctctaaa
agggcctcagcgaaggtaggcaagggaagtgaaaaatttttgatgaccgtcaaggggcag
gagcttcccatgcatgagccaagggggaaaaaaggcgtcgccataggatatgccctgtcg
cccacaggggccgaccacatgcagtttgcccacgaccctttgttcgcttctccggacagc
agacccatgaaggacattatggccctgggaatactggagcctctccctgtaacatatcta
ggacctgagaagataagggccatcacctacctatggtacttctgggctgccttcaaccac
ttgggatgctgttacttcgttttctctccaagaagctacttccctatacataggctccac
tccctggtggaggcggcaacaggttggaacataacactgtgggagctcatgaagatggga
gaacgggggttaaatgctgccaggctattcaatttgaaaatgggactcacatcgggggac
gatgtcattcccgagaggctccatactcctctgcccgatggggctttcaagggaagcaca
atcggaaaagatgagtttaaagatgccgtagccctttgttactccatgatgggatgggac
ggccaaggcattccaaaaagggaaaaactcgcggagcttggcctggaggaatttatttaa

DBGET integrated database retrieval system