KEGG   Thermovirga lienii: Tlie_0012Help
Entry
Tlie_0012         CDS       T01644                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tli  Thermovirga lienii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlie_0012
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tlie_0012
Enzymes [BR:tli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Tlie_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(14104..15963)
Genome map
AA seq 619 aa AA seqDB search
MSFGKAKRAWINLKSKEVSMEHLDEKYTRKWGGMRGLALPIMLKEIEKDTDPLGPLNLLI
VAAGLLNGLGFHGTCRYGIYAKSPLTGGFGGSDAGGYFGPALRAQGVDALVFKERAEKPV
YIWIEDEKVEIKDATDLWGLETGPALEKLREKHGKVTAILIGPAGENQVRFACVINDLHH
VNGRTGMGAVMGSKNIKAIVAPYPKAIPPKDPVLHQEMIKVFSNWKDDPLSFGLHVHGTA
GGVTRLNQDGILPTMNFQQGTFEGASSIDGKLMTETLLKERLGCFACAVRCKRVVGGGKY
DTDPNYGGPEYETMAALGSLCGVDDLDAVTKGHELCNRFGLDTISAGMTIAWLMECVEKG
IMTKDEAIVSGFGDAQGMLKLLEKIARREGIGDLLAEGSKRASAKVGKGSEKFLMTVKGQ
ELPMHEPRGKKGVAIGYALSPTGADHMQFAHDPLFASPDSRPMKDIMALGILEPLPVTYL
GPEKIRAITYLWYFWAAFNHLGCCYFVFSPRSYFPIHRLHSLVEAATGWNITLWELMKMG
ERGLNAARLFNLKMGLTSGDDVIPERLHTPLPDGAFKGSTIGKDEFKDAVALCYSMMGWD
GQGIPKREKLAELGLEEFI
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttggcaaggcaaaaagggcatggataaacttgaaaagcaaagaggtctcaatg
gaacacctcgatgaaaaatacacaaggaaatggggtggtatgagaggccttgcattgccc
ataatgctaaaggaaattgaaaaggatacagatcctctgggacctcttaaccttttgata
gtagcagcaggattgttgaatggcctaggtttccatggtacttgccgctatgggatttac
gccaaaagcccccttacaggagggtttggaggaagcgacgcaggtggctactttggacca
gccctcagggcccagggtgtggatgctctggtgttcaaagaaagggccgaaaaacccgtc
tacatctggattgaagatgaaaaggtggaaatcaaagacgcaacggatctatggggtctt
gagacaggcccagcactggagaaattgagggaaaaacacggcaaggtaacagccatactc
ataggccctgcaggagaaaaccaggttcgatttgcctgcgtcataaacgacttgcaccat
gtaaacggacgcactggcatgggagctgtgatgggatccaagaatataaaggccatagtt
gctccatatccaaaggccatacctccgaaagaccctgtccttcaccaggagatgataaaa
gtgttctccaactggaaggatgaccctctatccttcgggctgcacgttcacggtactgca
ggaggagtcaccaggctcaaccaggatgggatcctgcctacgatgaactttcaacaggga
accttcgaaggggcatcctccatcgacggaaagttaatgactgaaaccctcctaaaggaa
cgcttggggtgcttcgcctgcgctgtgcgctgcaaacgagtggtcggaggaggcaagtac
gatactgaccccaactacggcggccctgagtacgagaccatggcggccttgggttccctg
tgcggtgtagatgatctggacgcagtaaccaaggggcacgagctctgtaacaggtttgga
cttgatactatttcagcaggtatgacgatagcgtggctaatggaatgtgtagaaaaaggg
ataatgacaaaagacgaagctatcgtttccggcttcggagacgctcaaggcatgctcaaa
ctactggagaaaatagcccgaagggaaggtataggagaccttttggccgagggctctaaa
agggcctcagcgaaggtaggcaagggaagtgaaaaatttttgatgaccgtcaaggggcag
gagcttcccatgcatgagccaagggggaaaaaaggcgtcgccataggatatgccctgtcg
cccacaggggccgaccacatgcagtttgcccacgaccctttgttcgcttctccggacagc
agacccatgaaggacattatggccctgggaatactggagcctctccctgtaacatatcta
ggacctgagaagataagggccatcacctacctatggtacttctgggctgccttcaaccac
ttgggatgctgttacttcgttttctctccaagaagctacttccctatacataggctccac
tccctggtggaggcggcaacaggttggaacataacactgtgggagctcatgaagatggga
gaacgggggttaaatgctgccaggctattcaatttgaaaatgggactcacatcgggggac
gatgtcattcccgagaggctccatactcctctgcccgatggggctttcaagggaagcaca
atcggaaaagatgagtttaaagatgccgtagccctttgttactccatgatgggatgggac
ggccaaggcattccaaaaagggaaaaactcgcggagcttggcctggaggaatttatttaa

DBGET integrated database retrieval system