KEGG   Thermovirga lienii: Tlie_0575Help
Entry
Tlie_0575         CDS       T01644                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tli  Thermovirga lienii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlie_0575
   01230 Biosynthesis of amino acids
    Tlie_0575
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlie_0575
   00030 Pentose phosphate pathway
    Tlie_0575
   00051 Fructose and mannose metabolism
    Tlie_0575
   00052 Galactose metabolism
    Tlie_0575
  Energy metabolism
   00680 Methane metabolism
    Tlie_0575
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tlie_0575
Enzymes [BR:tli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tlie_0575
Protein phosphatases and associated proteins [BR:tli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tlie_0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
616502..617461
Genome map
AA seq 319 aa AA seqDB search
MKKIAILTSGGDAPGMNAAIRAVTRSAIGRGLTVYGFMRGYEGLLDRDFRVLSARDVGGI
IHRGGTILQTARSDRFMESFWQDRAAEFLKEEGIEGLVVIGGDGSFRGAAELAKRGISVV
GVPGTIDNDIAETDLTIGFRTAVETALDAVKRLRDTASSHDRLFIVEVMGRRSGFIALEV
GVASGAEAVLVPEVPFSLGMLNDKLHAARKKGKTHSLIILAEGVMSAQELKTQLKDTGGY
EARVTVLGHIQRGGSPCSVDIILASQMGKCAVDALLEGETAVMAASRCGKVQRVPLSWSW
ERRKLLDPDLMELVEVLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcgccattttgaccagcgggggcgatgcccctggaatgaatgccgccata
cgggccgtcaccagaagcgccataggacgagggcttacggtgtacggcttcatgcggggc
tacgaggggcttctggatagggatttcagagtgctcagcgcaagggacgtggggggcatc
atccacagggggggtaccatcctccagactgcccgaagcgaccggttcatggaaagcttt
tggcaggacagggcggcagaatttcttaaagaagagggcatagaaggtctcgtggtcatt
ggtggagacggctccttcagaggggctgctgagcttgcaaaaagaggcatatcagttgta
ggtgttccagggaccatcgacaatgacatagcagaaacggacctgaccataggttttcgg
actgccgtagagaccgccctggatgccgtaaagcgccttagggataccgcctcaagccac
gacaggctcttcatagtggaggtaatgggaagaaggtcgggcttcattgcccttgaggtg
ggagtcgcaagtggagcagaggccgtcctcgtgccggaagttcccttcagtttgggcatg
ctcaacgacaagcttcatgccgcccgaaagaagggcaagacccactctttgataatccta
gcagaaggggtaatgtcagctcaggaattaaagacccagctcaaggacacaggaggctac
gaggcaagagttaccgttttgggacacatacaaaggggcggaagcccctgttctgtggac
attatcctggcctcccagatgggaaagtgcgctgtggacgccctcttggagggtgaaacc
gcggtcatggccgcttcaaggtgcggcaaggtccagcgagtacccctgagctggtcctgg
gagcggaggaaacttttggatccagaccttatggaattggtggaggttttaagcatttga

DBGET integrated database retrieval system