KEGG   Thermovirga lienii: Tlie_0575Help
Entry
Tlie_0575         CDS       T01644                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tli  Thermovirga lienii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tli01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tli01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tli00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tli00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tli00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tli00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:tli00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
616502..617461
Genome map
AA seq 319 aa AA seqDB search
MKKIAILTSGGDAPGMNAAIRAVTRSAIGRGLTVYGFMRGYEGLLDRDFRVLSARDVGGI
IHRGGTILQTARSDRFMESFWQDRAAEFLKEEGIEGLVVIGGDGSFRGAAELAKRGISVV
GVPGTIDNDIAETDLTIGFRTAVETALDAVKRLRDTASSHDRLFIVEVMGRRSGFIALEV
GVASGAEAVLVPEVPFSLGMLNDKLHAARKKGKTHSLIILAEGVMSAQELKTQLKDTGGY
EARVTVLGHIQRGGSPCSVDIILASQMGKCAVDALLEGETAVMAASRCGKVQRVPLSWSW
ERRKLLDPDLMELVEVLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcgccattttgaccagcgggggcgatgcccctggaatgaatgccgccata
cgggccgtcaccagaagcgccataggacgagggcttacggtgtacggcttcatgcggggc
tacgaggggcttctggatagggatttcagagtgctcagcgcaagggacgtggggggcatc
atccacagggggggtaccatcctccagactgcccgaagcgaccggttcatggaaagcttt
tggcaggacagggcggcagaatttcttaaagaagagggcatagaaggtctcgtggtcatt
ggtggagacggctccttcagaggggctgctgagcttgcaaaaagaggcatatcagttgta
ggtgttccagggaccatcgacaatgacatagcagaaacggacctgaccataggttttcgg
actgccgtagagaccgccctggatgccgtaaagcgccttagggataccgcctcaagccac
gacaggctcttcatagtggaggtaatgggaagaaggtcgggcttcattgcccttgaggtg
ggagtcgcaagtggagcagaggccgtcctcgtgccggaagttcccttcagtttgggcatg
ctcaacgacaagcttcatgccgcccgaaagaagggcaagacccactctttgataatccta
gcagaaggggtaatgtcagctcaggaattaaagacccagctcaaggacacaggaggctac
gaggcaagagttaccgttttgggacacatacaaaggggcggaagcccctgttctgtggac
attatcctggcctcccagatgggaaagtgcgctgtggacgccctcttggagggtgaaacc
gcggtcatggccgcttcaaggtgcggcaaggtccagcgagtacccctgagctggtcctgg
gagcggaggaaacttttggatccagaccttatggaattggtggaggttttaagcatttga

DBGET integrated database retrieval system