KEGG   Thermovirga lienii: Tlie_0589Help
Entry
Tlie_0589         CDS       T01644                                 

Definition
(RefSeq) L-threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tli  Thermovirga lienii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tlie_0589
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tlie_0589
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tlie_0589
Enzymes [BR:tli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tlie_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
630428..631471
Genome map
AA seq 347 aa AA seqDB search
MAGLLERYRKYFPITDDTPIETLGEGETPLVKLNKIGSELGVELYGKYEGANPTGSFKDR
GMVLAMAKAAEGGAKAVICASTGNTSASAAAYAARFGLKCYVLLPAGKVALGKLSQALVY
GAKVIAIRGNFDRALELARKASSEMGLAIVNSVNPYRLWGQRSGAWEVCDELGVSPDWMV
LPVGNAGNITAYWTGFVQYKNEGKIKKVPQMVGIQAQGASPLVSGESFPNPETVATAIRI
GHPVNGKKAAWAVRMSGGFFSAVSDEEILLAQKELASKEGVFAEPASCAPLAGLKKAKRE
GKLPEGIKVVMVLTGNGLKDPQVILSGQEEICEIDGDESQLREVLSQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctggactgctcgaaaggtacagaaaatactttcctataaccgatgatacgcctatc
gagaccttgggggagggagaaacgcccctagtgaaactcaataaaataggctcagagttg
ggagtggagctctacgggaaatatgagggcgccaatcctacaggctccttcaaggatcgg
ggcatggttttggccatggccaaggcagcagaaggtggggctaaggccgtgatatgtgca
tcgacggggaacacttctgcctctgctgcagcctatgccgcaaggtttggccttaaatgt
tatgttttactgcccgcaggcaaggttgccttgggaaagctgtcccaagctttggtgtat
ggggctaaggtcatagccataaggggtaatttcgaccgtgcgttggaactggccaggaaa
gcctccagcgagatggggcttgccatagtcaactcggtaaatccatacaggctttggggt
cagcgcagcggtgcttgggaggtatgcgatgaacttggtgtttctccagattggatggtg
cttcccgtagggaacgctggaaacataacggcctattggactggtttcgtgcagtacaaa
aatgagggcaagataaaaaaggttccccaaatggtgggcatccaggcccagggagcctcg
ccccttgtttcgggtgaaagttttccgaatcctgagaccgtggcaactgcaatacgcata
gggcatccggtgaacggcaagaaagctgcctgggcagtcaggatgtccggtgggttcttt
tccgccgtctccgatgaggagatactccttgcccagaaagagctggcctcaaaggaggga
gttttcgcagaacctgcttcctgcgctccccttgcagggctcaagaaggcaaagagggag
ggcaaacttcccgagggtataaaggtggttatggtgttgactgggaacggcctcaaagat
cctcaggtgatcctttcaggtcaggaggaaatttgtgagatagacggtgacgaatcccag
ttgagggaggtgctgagccaatga

DBGET integrated database retrieval system