KEGG   Thermovirga lienii: Tlie_0762Help
Entry
Tlie_0762         CDS       T01644                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tli  Thermovirga lienii
Pathway
tli00040  Pentose and glucuronate interconversions
tli00052  Galactose metabolism
tli00500  Starch and sucrose metabolism
tli00520  Amino sugar and nucleotide sugar metabolism
tli01100  Metabolic pathways
tli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tlie_0762
   00052 Galactose metabolism
    Tlie_0762
   00500 Starch and sucrose metabolism
    Tlie_0762
   00520 Amino sugar and nucleotide sugar metabolism
    Tlie_0762
Enzymes [BR:tli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tlie_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AER66495
JGI: Tlie_0762
UniProt: G7V9E5
Position
797791..798690
Genome map
AA seq 299 aa AA seqDB search
MEKEEVSVKTCLFPVAGLGTRFLPATKEIPKEMLPVLDKPVIAYGVEEAVSSGCKKMIFV
TSKGKNSILDYFDRNLELERELERRGKKDLVEEIKRISEGIECASVRQSQPLGLGHAVLM
GEPFCDEPFFGVILPDDIMVSSEGSRPVLRQLVDVCEVRKASVVALMEVPPSETNRYGIV
EIDQTIGDGLFSIKGMVEKPSPEEAPSNFAIMGRYVLSSRIFEHIRKCAPGAGGEYQLTD
AIRSLLEEEPVYGLVFSGKRYDCGTKEAWLRTNVALALRDEALRSIVLEEVKKVEENCK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagaagaggtttctgttaagacttgcctttttcctgtggcgggtttgggtacc
aggtttcttcctgctaccaaggagatccctaaggagatgctaccagttttagacaaacct
gtaatagcgtacggtgtggaggaggcagtttcatcaggctgcaagaagatgatttttgtc
acgtcaaaggggaaaaattcgatcttggattattttgatcgaaaccttgaattggaaaga
gaactcgagagaagagggaaaaaagatctggtggaagagataaaacgtatttcggagggg
atcgaatgcgcttcggtgcgtcaaagccaaccgttaggcttgggacacgcagtcctgatg
ggcgaacccttttgtgatgaacccttttttggagtcatactgcccgatgacatcatggtc
tcctctgaaggatcccgaccagttttgagacagcttgtcgatgtatgtgaggtgcgaaag
gcttccgtcgtggctttgatggaggttccaccttcggaaactaacaggtacggtatagta
gagattgatcaaaccattggggatggccttttctcaataaagggaatggtagaaaaaccg
tccccagaggaagctcctagcaactttgccataatggggcgatacgtcctttcttcgagg
atatttgagcatattagaaaatgcgctcctggcgcaggaggagaatatcaacttactgat
gccataagatccctcctggaagaggagcctgtttacggtcttgttttttctggcaaacgg
tacgattgtggcaccaaggaagcttggcttagaaccaacgttgctttggccttgagggat
gaagcattgaggtccatagtattggaggaggtgaaaaaagtagaggaaaattgtaagtga

DBGET integrated database retrieval system