KEGG   Thermovirga lienii: Tlie_0917Help
Entry
Tlie_0917         CDS       T01644                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tli  Thermovirga lienii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tlie_0917
DNA repair and recombination proteins [BR:tli03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tlie_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
970685..971299
Genome map
AA seq 204 aa AA seqDB search
MDRDPLKKVISLLEKIPGVGEKTARRYALFLLQQSKEYSIELSKAILELKENTGSCPQCG
NITSSDGELCAICCDPMRDRETLCVLESLEDLLNFEHSGIYNGLYFVLGGRISPMEGEDL
DDERLKKLKDYVVEGKFKEVIIATNPKVEGDLTFYAVYDAIKDCNVAISRLAFGLPVGGN
IGYADRMTLHASLDSRVAIKDAKR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttggatagggatcctttaaagaaggtaatcagtctccttgaaaaaattccaggagtagga
gaaaagacggcacggcgttatgccctgtttttgctccaacagtcgaaggagtattctatt
gaactgtcaaaggcaatattagaactgaaagaaaatacagggtcttgtccgcaatgcggg
aatattacatcctccgatggtgagctttgtgctatttgttgtgaccctatgagggatagg
gagaccctttgtgtattggaaagcctagaagatttactcaactttgagcattcaggtatt
tacaacgggctttattttgttttaggcggacgaatttctcctatggaaggagaagacttg
gacgatgagagactcaaaaagcttaaggattacgtcgttgaaggaaaatttaaggaggtt
ataattgctacaaaccctaaagttgagggtgatttaaccttttatgcggtttatgatgcc
attaaagactgcaacgttgcaataagcaggttggcctttggcctcccagtggggggcaat
atagggtatgctgaccggatgaccctacatgcttctcttgattcaagagtggctataaaa
gacgcaaagagatag

DBGET integrated database retrieval system