KEGG   Thermovirga lienii: Tlie_0930Help
Entry
Tlie_0930         CDS       T01644                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tli  Thermovirga lienii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
983501..984157
Genome map
AA seq 218 aa AA seqDB search
MIFEERKWAELAENMVRTQIAARGISNGRILDALAKVPRHVFVPEELRFMAYDDCPLPIG
YGQTISQPYMVARMTELLDPKAGEKVLEIGTGSGYQAAVLAYLGAKVFSIERIEPLAKRA
QDNLRKLGLSASVIVGDGNKGLPEEAPFDAVIVTAASTEVAQAWKEQLKDDGRILLPLRL
HSGVERLLLLIRSEGKEEEQWYDYCRFVPLLPGVEKTM
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgaagagcgaaaatgggccgagcttgcagaaaacatggtcaggacccaaata
gcggcgaggggaatttccaacggaaggattttggatgctttagcgaaggttcctaggcat
gtatttgttccggaagaacttcgtttcatggcctatgacgattgccctttgcctataggg
tatggacaaaccatctctcaaccttatatggtggctcgaatgacagaacttttggaccct
aaggccggagaaaaagtactggaaataggtactggttctggttaccaagccgcggtattg
gcctatttaggggcgaaggttttttcaatcgagagaattgaaccactagcaaaaagagca
caagacaaccttcggaaattagggctcagtgcctctgttattgttggtgacggcaataaa
ggtttacccgaggaagcaccttttgatgcagtgattgtgactgcagcatctacggaagtg
gctcaagcttggaaagaacagctgaaagacgatggtagaatattgttgcctttacgatta
cactctggagtggagcggttgttgttgcttatacgtagcgaaggaaaagaagaagaacag
tggtacgattattgccgctttgtcccattacttcctggagtagaaaaaacaatgtaa

DBGET integrated database retrieval system