KEGG   Thermovirga lienii: Tlie_0961Help
Entry
Tlie_0961         CDS       T01644                                 

Definition
(GenBank) V-type ATPase 116 kDa subunit
  KO
K02123  
V/A-type H+/Na+-transporting ATPase subunit I
Organism
tli  Thermovirga lienii
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
V/A-type ATPase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Tlie_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1017953..1019968
Genome map
AA seq 671 aa AA seqDB search
MAVTKFKKASLVVLGEKEEAVVSVLQDLACCEIMPEPTDTRTHDWAKCIKSADEALADIR
SALRFLEPYYSEVSGKLERLLGEKPTVTVEELENLSNSIDLASLSSSVKKIERRMLDIRT
LLSKLDSNEEILIKLRQFPYSLAIISSGTVRISSIVGTLPVAYLERFQGLVAELLASDGE
LFVAPFTPKETDVTVVLMYDKKKADEVAEICEKVPFTKLDFPPELEGTPEEELSKIERNR
TELAKESENLERNAAKLASEWVPTLRNLLDYYSVIRTRYETLVNASRTEKVSVIKFWVPE
PAVGKLKEKLSKFGEELELIIEDPSDDDEPPTLLENPRWALPFEPLTRLYGAPKYGEIDP
TVPMAPFMFLFFGMCLGDGGYGVLIAFAITYLLSKYKIVGDTKNFLHLLLLGALSTIAVG
ALTGSWMGDMIDAFPFLALLKPLKDRLVVLNPMSDPITFLGISLALGVVQILFGLSIAFW
DSLRKKDYMAAFGDNGGWISLLIGLLLLGGVKSGFLGGAAGLLGKILSILGAAVLVATQG
REKTGLFRRLLSGVLSLYNITSYLGDILSYSRLLALGLATSAIAMIVNTLTNLVLSIPFV
GWILSIVIFVGGHLFSVVVNTLGAFIHSLRLQYVEFFSKFYSGGGRIFQPLEYRTRYVKI
VGSKPLGQQSK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaactaaattcaaaaaagcatctttggttgtgctaggagagaaagaagaggcg
gtagtgtccgttttgcaggatttggcgtgttgtgaaataatgccagagcccacggacacg
aggacccatgattgggctaaatgtataaaatcagcggatgaagcccttgctgatatacga
tctgccctgcgttttttggaaccgtactactcagaggtgtctggtaagttggagcgcctc
ttgggcgaaaaacctacagtcaccgttgaggaactggagaacctttcgaatagtattgat
cttgcaagtttgtcgtcctcggttaaaaaaatagagcgaagaatgttggatataaggacg
ttgctttccaagttggactccaacgaagagatattgatcaagttaagacagtttccgtat
tcactggctattatatccagtggtactgtacgcatatccagtatcgtaggaaccttgcct
gtagcctatcttgagaggttccaagggttggttgcagaattgctggcatctgatggagaa
ctgtttgttgctccatttactccaaaggaaacggatgtcaccgtagtattgatgtatgac
aaaaagaaggctgacgaagttgctgagatatgcgaaaaggttccgttcaccaagttggac
tttccaccagagcttgagggtactcccgaagaggagttgtccaaaattgaaagaaatcgg
acagagctagcaaaggaatcagagaaccttgaaaggaatgctgcaaaactggcttctgag
tgggttccaacgcttagaaacttgttggattactattctgttattaggactcgctatgaa
accttggttaatgcttctaggacggagaaggtcagtgttattaagttctgggttccagaa
cctgcggtaggaaagttaaaagaaaagctctctaaatttggagaggagcttgagctcata
atagaggatccatcagatgatgatgaaccacccactctgttggaaaatcctcgttgggct
ttgccatttgagcctttgacaaggctgtacggtgcacctaagtatggggagattgatcct
acggttcccatggctcccttcatgttcctcttttttgggatgtgtttgggcgatggtggc
tatggagttctcattgcttttgcaataacatatttgctctccaaatacaaaattgttgga
gatacaaagaatttcttgcacttgctgcttctaggtgctctgtctacgatagctgttggt
gccctcacaggtagttggatgggcgatatgattgatgcttttcctttcctagccttgctg
aaaccccttaaggacagattggttgtgttaaaccccatgtcggaccctatcactttcttg
gggatatcccttgctttgggggttgtacagatactctttggcctttctatcgcgttttgg
gatagcctgaggaaaaaagactacatggctgcttttggtgacaacggaggctggatttcc
cttttgataggacttcttttgcttggaggggtaaagagcggttttttaggaggagcagcc
gggttgctagggaaaatactttccatcttaggtgcggctgtgttggtcgcaacgcaaggt
agggagaaaacaggactgtttagaaggttgctgtcgggagtgttgagtttatataacata
acgtcgtacttgggggatattttgagttatagcaggcttttggctttgggtttggctact
tctgcgattgcgatgatagttaatactctgaccaaccttgtgttgtccataccatttgtt
ggttggatactgagcatagtaatatttgtgggcggccatcttttcagcgtggtagtcaac
actctcggtgctttcatccactctttgcgtctgcagtatgtggagtttttcagcaagttc
tatagcgggggaggaagaatctttcagcctctggaatacaggacccgctacgtaaagata
gtagggagtaagcccttgggacagcaaagtaagtaa

DBGET integrated database retrieval system