KEGG   Thermovirga lienii: Tlie_0973Help
Entry
Tlie_0973         CDS       T01644                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tli  Thermovirga lienii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tli00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tli00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1030519..1032054
Genome map
AA seq 511 aa AA seqDB search
MIKLKDLIAFLEAKGHLKEIYIPDGYREKWLSQEISDCFHDSKEVTKGSIFACIRGSKFD
GHDYVESARQKGASAILAEKTVKVDVPCIVVSDVRSVLGEVASAVHDFPSEKLIMIAVTG
TNGKTTTTYMTRTILEASGIKTGLIGTVIYDDGRNVSEASRTTPEASDVQRLLRNMINNG
CKACVMEASSHGIAQGRLSGCRYDVAVFTNLTPEHLDYHGDMESYFKTKSTLFENFMKNG
KGRFVINEDDEYGKILIDKHKDKTIAFTLREPRLVAKEHLKGVIKGMDLWGTSIEVKSSI
EGYNGLFLNLPTIGEYNAANALGAVGTAAFLGVEPKLVRDALKEMRSVPGRLEKYIFENG
PTAVIDYAHTPDALEKALSTLRKVCKGNLWVVFGLGGNRYQDNRPEMGKVASRLSDRIVI
TVDNPRNEDPRQIAMQIKEGADKIAGAQVDIILDRKEAVFYALDNAENDDIVLIAGKGPE
RNIIYADKVIPYNDGEAVEEWSVLRGRKKWN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaattaaaagacctgatagcttttcttgaggcgaaaggacatttaaaagaaatt
tacattccagatggttacagagaaaaatggttgagtcaggaaattagcgactgctttcac
gactcgaaggaagtgacaaaagggtccatatttgcatgtataaggggtagtaagttcgat
ggacatgattacgtcgaaagcgctcgtcaaaagggggcgtcagccatcttggctgaaaaa
acggtaaaagtggatgttccttgtattgtagtgagtgatgtgcgtagtgtactaggtgaa
gtagccagtgcagttcatgattttccatcggaaaaattgataatgatcgccgtgacaggt
acgaacggtaaaacaactacgacatatatgactagaaccattttggaagcctcagggatc
aaaacaggtttaatcggcacagttatctatgatgatggtcgtaatgtgtccgaagcttcg
cgtactacgcctgaagcctcagatgttcagcgactgctcagaaacatgatcaataacggg
tgtaaagcctgtgttatggaagcatcatctcatggcattgctcagggcaggctcagtgga
tgtaggtacgatgtggctgtattcactaatttgacaccagagcacctggattaccatgga
gatatggagtcttatttcaagactaagtccacattatttgaaaactttatgaaaaatggg
aaaggtcgttttgtaataaatgaggacgatgagtatgggaaaattttgatcgacaaacat
aaagataaaaccattgcttttacgttaagagagccaagattggttgcaaaagaacatctc
aagggcgttataaagggaatggacctatggggtacttccattgaggttaagtcatcaata
gaaggatacaatggcctgtttttaaatcttcctacgattggtgagtacaacgctgcaaac
gcccttggggcagttgggactgcagcgtttttgggagtagaaccgaaattagttagagat
gctcttaaagaaatgagaagcgttcctggaaggcttgaaaagtacatatttgaaaatggt
cctactgcggtaatagattatgctcacactcctgatgccttagagaaggctttgagtacc
ctcagaaaggtttgcaagggtaacctttgggttgtgttcggtttgggtggaaataggtat
caagataatcgtccagagatgggtaaggtggcttccaggctgtccgatagaatagttata
accgtggataatcccaggaatgaagatccccggcaaatagctatgcaaattaaagaagga
gctgataaaatagccggggctcaggtagacataattcttgataggaaagaggcggttttc
tacgccctagacaatgctgaaaacgacgacattgtcttaatagctggtaaagggcccgaa
aggaacattatatacgccgataaagtcattccttacaacgatggggaagctgtagaggag
tggagtgttttgagaggtaggaaaaaatggaattag

DBGET integrated database retrieval system