KEGG   Thermovirga lienii: Tlie_0997Help
Entry
Tlie_0997         CDS       T01644                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tli  Thermovirga lienii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlie_0997
   01230 Biosynthesis of amino acids
    Tlie_0997
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlie_0997
   00051 Fructose and mannose metabolism
    Tlie_0997
   00562 Inositol phosphate metabolism
    Tlie_0997
Enzymes [BR:tli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tlie_0997
Exosome [BR:tli04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tlie_0997
  Exosomal proteins of bladder cancer cells
   Tlie_0997
  Exosomal proteins of melanoma cells
   Tlie_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1058690..1059502
Genome map
AA seq 270 aa AA seqDB search
MVVQKRKPIVVAANWKMNLGPSAAGDYLKDFIELVKKDTRLISSIDNKEVEVIFFPPSVS
LPCVHSHLGTNYFMLGAQNAHWLPSGAYTGEISIPMLKEVGVTHVLVGHSERRWLFHETD
EVISLKVKACFEFGVSPVLCVGEREEDRLDNKTEEVIEKQVRHGLSFLKDFNMKITDALY
IAYEPVWAIGTGKTASPKDAQEAIGFIRELIGTIYGRNCADAVRILYGGSVNPENAEDLI
MQEDINGLLVGSASLNPNKFCRILSNVTVL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggtggttcaaaaaagaaaacccattgtggtggctgctaattggaagatgaacctcggt
ccttctgcagccggagactacctaaaggatttcatagaactagtgaagaaagacacaagg
ttgattagctccatagataacaaagaggtggaagtgatatttttcccgccgtcggtatct
cttccttgtgtccattcccacctcggcaccaactatttcatgttaggtgcgcagaatgct
cactggcttcctagcggggcttacactggtgaaatatccatcccaatgttgaaggaagtc
ggggtaacccatgtgcttgtgggccacagcgaaaggcgctggctttttcatgagactgat
gaagttataagccttaaagtcaaggcttgtttcgagttcggagtgtcgccggtactgtgt
gtaggtgaaagggaagaggatcgtttggacaataaaactgaagaagtgatagaaaagcaa
gtcagacatggcctttcttttttgaaagatttcaatatgaagataacagatgccctttac
atagcctatgagccggtttgggccataggtacagggaaaacagcttctcccaaagacgcg
caagaagccattgggtttataagagagcttatcggaactatttatggtcgaaactgtgca
gatgctgtgaggatattgtatggaggaagtgtgaatcctgagaatgcagaggatttgata
atgcaagaagatatcaatggccttttagttggttctgcttccttaaaccccaataaattt
tgtagaattctttcaaacgttaccgttttgtga

DBGET integrated database retrieval system