KEGG   Thermovirga lienii: Tlie_0997Help
Entry
Tlie_0997         CDS       T01644                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tli  Thermovirga lienii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlie_0997
   01230 Biosynthesis of amino acids
    Tlie_0997
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlie_0997
   00051 Fructose and mannose metabolism
    Tlie_0997
   00562 Inositol phosphate metabolism
    Tlie_0997
Enzymes [BR:tli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tlie_0997
Exosome [BR:tli04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tlie_0997
  Exosomal proteins of bladder cancer cells
   Tlie_0997
  Exosomal proteins of melanoma cells
   Tlie_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1058690..1059502
Genome map
AA seq 270 aa AA seqDB search
MVVQKRKPIVVAANWKMNLGPSAAGDYLKDFIELVKKDTRLISSIDNKEVEVIFFPPSVS
LPCVHSHLGTNYFMLGAQNAHWLPSGAYTGEISIPMLKEVGVTHVLVGHSERRWLFHETD
EVISLKVKACFEFGVSPVLCVGEREEDRLDNKTEEVIEKQVRHGLSFLKDFNMKITDALY
IAYEPVWAIGTGKTASPKDAQEAIGFIRELIGTIYGRNCADAVRILYGGSVNPENAEDLI
MQEDINGLLVGSASLNPNKFCRILSNVTVL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggtggttcaaaaaagaaaacccattgtggtggctgctaattggaagatgaacctcggt
ccttctgcagccggagactacctaaaggatttcatagaactagtgaagaaagacacaagg
ttgattagctccatagataacaaagaggtggaagtgatatttttcccgccgtcggtatct
cttccttgtgtccattcccacctcggcaccaactatttcatgttaggtgcgcagaatgct
cactggcttcctagcggggcttacactggtgaaatatccatcccaatgttgaaggaagtc
ggggtaacccatgtgcttgtgggccacagcgaaaggcgctggctttttcatgagactgat
gaagttataagccttaaagtcaaggcttgtttcgagttcggagtgtcgccggtactgtgt
gtaggtgaaagggaagaggatcgtttggacaataaaactgaagaagtgatagaaaagcaa
gtcagacatggcctttcttttttgaaagatttcaatatgaagataacagatgccctttac
atagcctatgagccggtttgggccataggtacagggaaaacagcttctcccaaagacgcg
caagaagccattgggtttataagagagcttatcggaactatttatggtcgaaactgtgca
gatgctgtgaggatattgtatggaggaagtgtgaatcctgagaatgcagaggatttgata
atgcaagaagatatcaatggccttttagttggttctgcttccttaaaccccaataaattt
tgtagaattctttcaaacgttaccgttttgtga

DBGET integrated database retrieval system