KEGG   Thermovirga lienii: Tlie_1032Help
Entry
Tlie_1032         CDS       T01644                                 

Definition
(RefSeq) Holliday junction DNA helicase subunit RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tli  Thermovirga lienii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tlie_1032
Enzymes [BR:tli01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tlie_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1092213..1092818)
Genome map
AA seq 201 aa AA seqDB search
MLRYLEGTVFEKKQDTIGLMVGGFGFLIQCSKKVMETTILGEQKGLYTYLHVSENGFSLF
GFQDEEELEVFQMLMKVKGVGAKSAMSFMRFLNLEEITRAIAFSEIALLTTVPGVGKKTA
ERICFELKQKMLKHGDSKPDLALDAHISNSVTEAMITLGFSPGEAVRAIRGALEKKGGFS
SEEELLQAALQEVQVRKTYSD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgctccgctatcttgagggtacagtttttgaaaaaaaacaggataccattggactgatg
gtcggtgggtttggtttcttgatccaatgctcaaagaaggtcatggaaacgaccatttta
ggagagcaaaaagggctttacacttatttgcatgtaagcgaaaacggcttcagccttttc
ggttttcaagatgaagaggagcttgaggtgtttcagatgctgatgaaagtaaaaggggtt
ggagccaagtcagctatgtcatttatgcgtttcttaaatctggaagaaattacacgtgcc
atagctttttcggaaatagccctgttgacgaccgtccctggtgtgggtaaaaaaactgca
gaaagaatatgctttgagctgaagcaaaaaatgttaaaacatggagactcaaaaccagac
cttgccttggatgctcatataagtaatagcgttaccgaagccatgataacgctgggattt
tctccgggcgaagctgtaagagctatacgaggagcgctggagaaaaagggcggtttttct
tcagaagaagagctgctacaagcagcactacaagaagttcaggtccgcaaaacttacagt
gattag

DBGET integrated database retrieval system