KEGG   Thermovirga lienii: Tlie_1044Help
Entry
Tlie_1044         CDS       T01644                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
tli  Thermovirga lienii
Pathway
tli00330  Arginine and proline metabolism
tli01100  Metabolic pathways
Module
tli_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tlie_1044
Enzymes [BR:tli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Tlie_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase ESAG1
Motif
Other DBs
NCBI-ProteinID: AER66777
JGI: Tlie_1044
UniProt: G7VA77
Position
complement(1102266..1103132)
Genome map
AA seq 288 aa AA seqDB search
MKRFISASASGFKKAEWILLGAPLDSTVSRQPGSSKAPQSIRDESWNLETFSFSIKRDLE
DVNFFDIGDLVLQCRPIEIALDIIYKVANHLFKNRKKVLSFGGEHLVSYGLIKAAAETHP
GLHVIHLDAHADLRDTYHGERFTHATVMRRVAEECLDTPSNLYQFGIRSGTKQEYEWGKN
NTRLFEEQDIVSALSNVINDLQDKPIYISLDIDIFDPSIAPGTGTPEPGGVIDYREVLNF
MTTMSSLNIVGMDIVEVCPLLDINNITSVLAAKIAREALLLWGVEKVV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaggtttatttctgctagtgcgtctggattcaagaaagcggagtggatattgtta
ggtgcgccgttggacagcacagtctctagacagccaggtagcagcaaagctccacagtcc
ataagagatgaatcgtggaatcttgaaacctttagcttttcgataaaaagggatcttgag
gatgtcaatttctttgatattggcgatttggttctacagtgcaggcccatcgagatagct
ttagatataatttataaagtagcaaaccaccttttcaaaaataggaagaaagtgctttcc
tttggaggggagcacttagtttcttatgggttgataaaggccgcagcagagactcacccc
ggtttgcatgtcattcatttagatgcgcatgcggatttgcgcgatacttatcatggagag
agatttactcatgcaaccgttatgaggcgagtggcagaggagtgcctcgataccccctca
aacttgtaccaatttggaattagatctggcacaaagcaagaatacgagtggggcaaaaac
aataccaggttatttgaggagcaggatatagtttcagctttgtccaacgttattaatgat
ttgcaggataaacccatatatataagccttgacatagacatttttgatccctccatcgca
cctggaacaggtactcccgaaccaggaggcgttatagattacagagaagtgctaaatttc
atgacgactatgagctctttgaatattgtaggaatggacattgtagaagtttgtccttta
ttggatatcaataacataacctcagtattggcagctaaaattgccagagaagctttgtta
ttgtggggggtggaaaaggttgtttga

DBGET integrated database retrieval system