KEGG   Thermovirga lienii: Tlie_1117Help
Entry
Tlie_1117         CDS       T01644                                 

Definition
(GenBank) thiamine pyrophosphate TPP-binding domain-containing protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tli  Thermovirga lienii
Pathway
tli00010  Glycolysis / Gluconeogenesis
tli00020  Citrate cycle (TCA cycle)
tli00620  Pyruvate metabolism
tli00640  Propanoate metabolism
tli00650  Butanoate metabolism
tli00680  Methane metabolism
tli01100  Metabolic pathways
tli01120  Microbial metabolism in diverse environments
tli01130  Biosynthesis of antibiotics
tli01200  Carbon metabolism
Module
tli_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlie_1117
   00020 Citrate cycle (TCA cycle)
    Tlie_1117
   00620 Pyruvate metabolism
    Tlie_1117
   00640 Propanoate metabolism
    Tlie_1117
   00650 Butanoate metabolism
    Tlie_1117
  Energy metabolism
   00680 Methane metabolism
    Tlie_1117
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tlie_1117
Enzymes [BR:tli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tlie_1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C zf-NADH-PPase
Motif
Other DBs
NCBI-ProteinID: AER66850
JGI: Tlie_1117
UniProt: G7V567
Position
1175999..1176940
Genome map
AA seq 313 aa AA seqDB search
MAVRLKDFTTKDTPMTRGHRMCPGCGAPTAVRQGLLAVDKPVVITCATGCLEVSTTIYPY
NAWNAPFLHCAFENAGANISGIEAAYVALKKKGKINKDIKFVAFGGDGGTYDIGLQALSG
AAERGHDFTYICYNNQAYMNTGAQRSSATPTGASSTTAPAGKKIPGKVQRAKDLTDIMAA
HHIPYVAQTTLHNPQDVIEKVKKAIETPGPSFVNILVPCVLFWRIEPAMQRDICKLAADT
RIWPIYEVINGEWKLSYKPRSFVPVEEFLKPQGRFRHLFKGDAWKPVVEQLQQEVEEKWA
YVLERCKETWEPK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctgttagactaaaagatttcactaccaaagatacacctatgacaagggggcacaga
atgtgccctggatgtggagcaccaacagcagttcgccaaggccttttggcggtagataag
ccggttgttattacctgcgccacgggatgtttggaagtctccactactatttatccatac
aacgcttggaatgctcccttcctacattgtgcttttgagaacgcaggcgccaacatttct
ggcatagaggccgcttatgttgcattgaagaaaaaaggcaaaataaacaaggatataaag
tttgtagcatttggcggagacggtggaacttacgatattggtcttcaggctttgtctgga
gcagctgagcgaggacatgacttcacctatatttgctacaacaaccaggcctacatgaac
acgggagcacaaagaagcagcgctactccaacaggtgctagctccaccactgcacctgca
ggaaagaaaatacctggcaaggtacaacgcgctaaggatttaaccgatataatggctgca
catcatattccctacgtagcacaaacgacgttgcacaaccctcaagatgtgatcgaaaaa
gtcaaaaaagctatagaaactcctggaccatctttcgtgaacatattggttccctgcgtc
ctcttctggaggatagagccagccatgcagagagatatttgcaaactagcagccgacacg
aggatatggccaatctatgaggtaataaacggagagtggaagctatcatacaagccaaga
agctttgtccccgttgaggagttcctaaagccacaaggaaggttcaggcacctgttcaag
ggagatgcatggaagcctgtagtggaacagcttcaacaggaagtagaagaaaaatgggcg
tacgttctggagcgctgcaaagaaacttgggaacccaaatag

DBGET integrated database retrieval system