KEGG   Thermovirga lienii: Tlie_1117Help
Entry
Tlie_1117         CDS       T01644                                 

Definition
thiamine pyrophosphate TPP-binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
tli  Thermovirga lienii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlie_1117
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlie_1117
   00020 Citrate cycle (TCA cycle)
    Tlie_1117
   00620 Pyruvate metabolism
    Tlie_1117
   00640 Propanoate metabolism
    Tlie_1117
   00650 Butanoate metabolism
    Tlie_1117
  Energy metabolism
   00680 Methane metabolism
    Tlie_1117
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tlie_1117
Enzymes [BR:tli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tlie_1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1175999..1176940
Genome map
AA seq 313 aa AA seqDB search
MAVRLKDFTTKDTPMTRGHRMCPGCGAPTAVRQGLLAVDKPVVITCATGCLEVSTTIYPY
NAWNAPFLHCAFENAGANISGIEAAYVALKKKGKINKDIKFVAFGGDGGTYDIGLQALSG
AAERGHDFTYICYNNQAYMNTGAQRSSATPTGASSTTAPAGKKIPGKVQRAKDLTDIMAA
HHIPYVAQTTLHNPQDVIEKVKKAIETPGPSFVNILVPCVLFWRIEPAMQRDICKLAADT
RIWPIYEVINGEWKLSYKPRSFVPVEEFLKPQGRFRHLFKGDAWKPVVEQLQQEVEEKWA
YVLERCKETWEPK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctgttagactaaaagatttcactaccaaagatacacctatgacaagggggcacaga
atgtgccctggatgtggagcaccaacagcagttcgccaaggccttttggcggtagataag
ccggttgttattacctgcgccacgggatgtttggaagtctccactactatttatccatac
aacgcttggaatgctcccttcctacattgtgcttttgagaacgcaggcgccaacatttct
ggcatagaggccgcttatgttgcattgaagaaaaaaggcaaaataaacaaggatataaag
tttgtagcatttggcggagacggtggaacttacgatattggtcttcaggctttgtctgga
gcagctgagcgaggacatgacttcacctatatttgctacaacaaccaggcctacatgaac
acgggagcacaaagaagcagcgctactccaacaggtgctagctccaccactgcacctgca
ggaaagaaaatacctggcaaggtacaacgcgctaaggatttaaccgatataatggctgca
catcatattccctacgtagcacaaacgacgttgcacaaccctcaagatgtgatcgaaaaa
gtcaaaaaagctatagaaactcctggaccatctttcgtgaacatattggttccctgcgtc
ctcttctggaggatagagccagccatgcagagagatatttgcaaactagcagccgacacg
aggatatggccaatctatgaggtaataaacggagagtggaagctatcatacaagccaaga
agctttgtccccgttgaggagttcctaaagccacaaggaaggttcaggcacctgttcaag
ggagatgcatggaagcctgtagtggaacagcttcaacaggaagtagaagaaaaatgggcg
tacgttctggagcgctgcaaagaaacttgggaacccaaatag

DBGET integrated database retrieval system