KEGG   Thermovirga lienii: Tlie_1251Help
Entry
Tlie_1251         CDS       T01644                                 

Definition
glutamyl-tRNA(Gln) amidotransferase subunit B
Orthology
K02434  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
tli  Thermovirga lienii
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tli00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1306376..1307842)
Genome map
AA seq 488 aa AA seqDB search
MSKKYITVIGLEVHVQLKTKSKLFCSCSTDYIGAMPNSNVCPVCLGLPGTLPVLNKKAVE
LALKMSCAIGGNIQKESRFHRKNYFYPDLPKAYQISQYDRPISFGGKIPIKTEQGEKFIG
ITRLHLEEDAGKLVHATLDGRLHGSGASYVDYNRAGVPLIEIVSEPQISTPEEAKEYVLA
LRKLVRYLGVSDGDMESGSMRVDANISLNEEGQPLGVKVEIKNMNSLRALQRALEYEQKR
QKELLMSGGTVVQETRHWDDAKGITVSSRSKEEAHDYRYFPDPDLPLVVVSEEMVEEVAS
SIPELPWEKKERYMFEFSISEEEAEILTSQIELARYFENALSFGAPVKPLVNWMKTEVIR
SNKEGKFNLENPEIEAQTLAKLIKLLDEKKISNTAGKDLWQIMLDKKVGLEEAMKDAGIA
VGGIDDQKLEEIVDKILKQNQDVVKEILEGKDTKGKKIKFLMGLVMRETRGQAKPQMVED
MLKSKIGQ
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaagaagtacataaccgttataggattagaggtacacgtacaattaaagactaaa
agcaaacttttttgttcttgttccaccgactacataggtgctatgccaaacagcaacgtt
tgcccagtttgtctaggacttcctggcaccctgccagtcctaaataaaaaggctgtggag
ctggcattgaaaatgtcgtgcgccattggcggtaacatccaaaaggagagccgctttcat
aggaaaaactatttctacccggacctacctaaagcctatcaaataagccaatacgaccgc
cctatctcctttggtggcaagatacctataaagacagagcaaggggaaaaatttatagga
ataactcgattgcacctggaagaggacgcaggcaaacttgtgcatgccacattggatgga
agacttcatggttctggagcttcttatgtggattataatagggcaggtgttccgctgata
gagattgtatcggaacctcaaatttccactcctgaggaggctaaggaatacgttcttgca
ttgagaaagttggttcggtatctaggagtgtccgatggtgatatggagtctggctccatg
agagtggatgccaacatatcgttgaacgaggaagggcaacccctcggtgtaaaggtggag
atcaagaacatgaactccctaagggccctccagcgtgctctggaatatgagcagaaaaga
cagaaggaacttttaatgtcaggaggcacagtggttcaggagactcgccactgggatgat
gctaaaggaatcaccgtctcaagcagaagtaaagaggaggcccatgattaccgatatttc
cccgatccagacttgcctttggttgtagttagcgaagagatggtagaagaggtggcaagc
tctataccagagctcccatgggaaaaaaaggaaaggtacatgtttgagttctccatcagc
gaagaagaggcggaaattttgacatcccaaattgagctggccagatattttgagaatgcc
ctttcttttggtgctcccgtcaaacccttggtaaactggatgaagaccgaggttatcaga
tctaacaaagagggtaagttcaatctggagaaccccgagattgaagctcagactctggct
aaactaattaaacttttggacgaaaagaaaatatccaataccgctggaaaagatttatgg
caaataatgctcgataaaaaggttggccttgaagaggcaatgaaagatgctggcatagca
gtgggtgggatagatgatcaaaagttagaggaaatagtggataaaattttgaagcaaaac
caggatgtggtaaaggaaatactggaaggtaaagacaccaaaggaaagaagataaaattc
ttaatggggctggtgatgcgggagacgagaggacaagctaaacctcagatggtagaagat
atgttgaaaagcaaaattgggcagtaa

DBGET integrated database retrieval system