KEGG   Thermovirga lienii: Tlie_1356Help
Entry
Tlie_1356         CDS       T01644                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tli  Thermovirga lienii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tli00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1427901..1429112
Genome map
AA seq 403 aa AA seqDB search
MLPYLINIRSDKDLVDILEKINADKRSFPYFRAKKDTYAIFLRDVDYRAANALKQEMLSR
GGDAIVHRNVIQGTIDKSDVVLLGTISSLEKLAKKLEAMPYWGLEKIKGELEKFFQNLAI
KGWNIVLGSGKSIELNDNTQIMGILNITPDSFYSTSRAMELDECVKRAFEMKEQGAIILD
IGAESSRPGSEPVPAETEKERLLPVIQRLRKEGFDLPISVDTTKSEIAKAALGEGADIIN
DISAGILDPEILRVAAQEKAPIILMHMKGTPKTMQLNPHYNNLLGELLDFFKERMDAAHK
AGVDTNKIILDPGLGFGKTKDHNLMILKNLKAFAGLGRPILIGHSRKSTIGAVLKKDDPK
DRLQGTLAITALCAWQDVPIVRVHDVRENYDVVRMINAIKEVK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgcttccatacttgatcaacataagatccgacaaagacctcgtagatatcctagaaaaa
atcaacgcagacaaaaggtcttttccctatttccgcgcaaaaaaggacacctatgccatt
tttttgagggacgtagattacagggctgccaatgcgttaaaacaggagatgctgtcccgg
ggcggagacgccatcgttcacaggaacgtaatacaaggaaccatcgataaaagcgacgta
gtacttttgggaacaataagctccctggaaaaactggcgaaaaagctggaggccatgcca
tattggggacttgagaaaatcaagggcgagcttgaaaaattttttcagaatttagcgatt
aagggttggaacatcgtcttgggtagcgggaagagcatagaactgaacgacaatacccag
atcatgggtatacttaacattacaccggactccttctactccactagccgtgcgatggag
ctggatgaatgcgtaaaaagagcatttgaaatgaaggagcaaggagccataatccttgac
ataggggcagaatcatcccgccccggttctgaaccagtaccagcggaaacggagaaagaa
aggcttctacctgtcatacaaagactccgtaaggaaggtttcgacctgcccatatccgta
gatacaacaaaatccgagatagcaaaagctgcactcggagaaggagcggacataatcaac
gatatctcggcaggcatcttggaccctgagatcctgcgcgttgcagcccaggaaaaggcg
ccgataattcttatgcatatgaagggtactcccaaaactatgcagcttaatcctcactac
aataaccttcttggcgaactccttgacttcttcaaggaacgaatggacgcagctcacaaa
gcaggtgtagataccaacaaaataatattagatcctgggctgggctttggtaaaacaaaa
gatcataatttaatgatattaaaaaacttaaaggcttttgctggtttaggtcgtcccata
ctcataggccactcccgaaaaagcaccataggtgcagtactgaaaaaagacgatcccaaa
gaccgtctacaaggcacattggcgataactgccctatgtgcttggcaggatgtgcctatc
gttagggtccacgacgttagggaaaactacgacgtcgtaagaatgataaacgcaataaag
gaggtcaaatag

DBGET integrated database retrieval system