KEGG   Thermovirga lienii: Tlie_1356Help
Entry
Tlie_1356         CDS       T01644                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tli  Thermovirga lienii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tlie_1356
Enzymes [BR:tli01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Tlie_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1427901..1429112
Genome map
AA seq 403 aa AA seqDB search
MLPYLINIRSDKDLVDILEKINADKRSFPYFRAKKDTYAIFLRDVDYRAANALKQEMLSR
GGDAIVHRNVIQGTIDKSDVVLLGTISSLEKLAKKLEAMPYWGLEKIKGELEKFFQNLAI
KGWNIVLGSGKSIELNDNTQIMGILNITPDSFYSTSRAMELDECVKRAFEMKEQGAIILD
IGAESSRPGSEPVPAETEKERLLPVIQRLRKEGFDLPISVDTTKSEIAKAALGEGADIIN
DISAGILDPEILRVAAQEKAPIILMHMKGTPKTMQLNPHYNNLLGELLDFFKERMDAAHK
AGVDTNKIILDPGLGFGKTKDHNLMILKNLKAFAGLGRPILIGHSRKSTIGAVLKKDDPK
DRLQGTLAITALCAWQDVPIVRVHDVRENYDVVRMINAIKEVK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgcttccatacttgatcaacataagatccgacaaagacctcgtagatatcctagaaaaa
atcaacgcagacaaaaggtcttttccctatttccgcgcaaaaaaggacacctatgccatt
tttttgagggacgtagattacagggctgccaatgcgttaaaacaggagatgctgtcccgg
ggcggagacgccatcgttcacaggaacgtaatacaaggaaccatcgataaaagcgacgta
gtacttttgggaacaataagctccctggaaaaactggcgaaaaagctggaggccatgcca
tattggggacttgagaaaatcaagggcgagcttgaaaaattttttcagaatttagcgatt
aagggttggaacatcgtcttgggtagcgggaagagcatagaactgaacgacaatacccag
atcatgggtatacttaacattacaccggactccttctactccactagccgtgcgatggag
ctggatgaatgcgtaaaaagagcatttgaaatgaaggagcaaggagccataatccttgac
ataggggcagaatcatcccgccccggttctgaaccagtaccagcggaaacggagaaagaa
aggcttctacctgtcatacaaagactccgtaaggaaggtttcgacctgcccatatccgta
gatacaacaaaatccgagatagcaaaagctgcactcggagaaggagcggacataatcaac
gatatctcggcaggcatcttggaccctgagatcctgcgcgttgcagcccaggaaaaggcg
ccgataattcttatgcatatgaagggtactcccaaaactatgcagcttaatcctcactac
aataaccttcttggcgaactccttgacttcttcaaggaacgaatggacgcagctcacaaa
gcaggtgtagataccaacaaaataatattagatcctgggctgggctttggtaaaacaaaa
gatcataatttaatgatattaaaaaacttaaaggcttttgctggtttaggtcgtcccata
ctcataggccactcccgaaaaagcaccataggtgcagtactgaaaaaagacgatcccaaa
gaccgtctacaaggcacattggcgataactgccctatgtgcttggcaggatgtgcctatc
gttagggtccacgacgttagggaaaactacgacgtcgtaagaatgataaacgcaataaag
gaggtcaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system