KEGG   Thermovirga lienii: Tlie_1572Help
Entry
Tlie_1572         CDS       T01644                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tli  Thermovirga lienii
Pathway
tli00010  Glycolysis / Gluconeogenesis
tli00030  Pentose phosphate pathway
tli00051  Fructose and mannose metabolism
tli00052  Galactose metabolism
tli00230  Purine metabolism
tli00500  Starch and sucrose metabolism
tli00520  Amino sugar and nucleotide sugar metabolism
tli01100  Metabolic pathways
tli01110  Biosynthesis of secondary metabolites
tli01120  Microbial metabolism in diverse environments
tli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlie_1572
   00030 Pentose phosphate pathway
    Tlie_1572
   00051 Fructose and mannose metabolism
    Tlie_1572
   00052 Galactose metabolism
    Tlie_1572
   00500 Starch and sucrose metabolism
    Tlie_1572
   00520 Amino sugar and nucleotide sugar metabolism
    Tlie_1572
  Nucleotide metabolism
   00230 Purine metabolism
    Tlie_1572
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tlie_1572
Enzymes [BR:tli01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Tlie_1572
    5.4.2.8  phosphomannomutase
     Tlie_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AER67294
JGI: Tlie_1572
UniProt: G7V7P0
Position
1634733..1636115
Genome map
AA seq 460 aa AA seqDB search
MPVPEHIFREYDIRGLADEELNSENVQAIALAFGTLLKRKGIGRICLGGDVRPSTERIRK
DVIEGITLAGIDVTDVGVVTTPMLYWSLYHYGVNGGIMITGSHNPPEFNGLKLAVGKTTL
YGRQIKEIYDMISKNDLEKGTKKGSVFSESINEPYINMLLSKITLGPKKLKVVTDSGNGT
AGPIINEYLKRSGCEVVPLFAEPDGRFPNHHPDPTKRENLGTLIDTVIKEKADVGLGFDG
DADRIGVVDDQGNIVWGDILMILFWREILPKHPGAKAIVEIKSSQALVDEIERLGGEVVW
WKSGHSLIKAKMKELNALFSGEVSGHMFFADEYYGFDDSFYAAGRLLRILSNSDKSLSEM
LSDVPKYYSTAETRIPCSDEEKFQVIEKIKESALKDYDAITIDGVRILYPRGWGLVRASN
TQPVLVARAEGKTEKDLEEYCNDLKKRILEAGVDDFQWEY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaccagagcacatattcagggaatacgacataaggggtttagccgacgaagaa
ttgaacagcgagaacgtccaagccatagcccttgcctttggcaccctcttaaaaaggaaa
ggaattgggcgaatatgcctgggaggagacgtcaggccttccaccgaaaggatcagaaag
gacgtaatagaaggaataacccttgcaggtatagacgttacggacgtgggagtggtaacg
acccccatgctctattggagcctttaccattacggtgtgaacggtggcataatgataact
ggcagtcacaaccctccagagttcaacggcctcaagcttgcagtgggcaagaccaccctt
tatggaagacagatcaaggaaatttacgacatgatctctaaaaacgaccttgagaaagga
accaaaaagggctctgtattctctgaatcaatcaacgaaccttacatcaacatgctcctt
tcaaaaataaccctagggcctaagaaactcaaggtcgtcacggactcaggaaacggtaca
gccggtcccatcataaacgaatatttgaaaagatcaggatgcgaagtcgttccactcttc
gcagaacctgacggccgattccctaaccaccaccccgacccaactaagagagagaacctc
ggaacccttatagacacagtgataaaggaaaaagctgacgtggggctaggcttcgacgga
gatgctgaccgtatcggagttgtggatgaccaagggaacatagtgtggggagatattcta
atgatcctcttctggcgggaaatacttcccaaacatccaggagcaaaagctatagtggaa
ataaaaagctcccaggcattggtggacgaaatagaacgattgggtggggaggtagtatgg
tggaaatcaggccactcgctcattaaggccaagatgaaggaactaaacgccctcttctcc
ggagaagtttcagggcacatgttctttgccgatgaatattatggctttgatgattccttt
tacgcagcgggaagactgctgaggatcctatccaactcggataaaagcctctcggaaatg
ctctcagacgtgccgaaatattacagcaccgctgaaactcgcatcccctgcagtgatgaa
gaaaagtttcaagttatcgaaaaaataaaggaaagcgccctcaaagattacgacgctata
actatagatggagtaagaatcctatatccaaggggttggggattggtaagggcttccaac
acccagccagttttggtcgccagagcggaaggaaagacagaaaaagaccttgaggaatat
tgcaatgacctcaagaaacggatccttgaggctggcgtggatgacttccagtgggaatac
tga

DBGET integrated database retrieval system