KEGG   Thermovirga lienii: Tlie_1572Help
Entry
Tlie_1572         CDS       T01644                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tli  Thermovirga lienii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlie_1572
   00030 Pentose phosphate pathway
    Tlie_1572
   00051 Fructose and mannose metabolism
    Tlie_1572
   00052 Galactose metabolism
    Tlie_1572
   00500 Starch and sucrose metabolism
    Tlie_1572
   00520 Amino sugar and nucleotide sugar metabolism
    Tlie_1572
  Nucleotide metabolism
   00230 Purine metabolism
    Tlie_1572
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tlie_1572
Enzymes [BR:tli01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Tlie_1572
    5.4.2.8  phosphomannomutase
     Tlie_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1634733..1636115
Genome map
AA seq 460 aa AA seqDB search
MPVPEHIFREYDIRGLADEELNSENVQAIALAFGTLLKRKGIGRICLGGDVRPSTERIRK
DVIEGITLAGIDVTDVGVVTTPMLYWSLYHYGVNGGIMITGSHNPPEFNGLKLAVGKTTL
YGRQIKEIYDMISKNDLEKGTKKGSVFSESINEPYINMLLSKITLGPKKLKVVTDSGNGT
AGPIINEYLKRSGCEVVPLFAEPDGRFPNHHPDPTKRENLGTLIDTVIKEKADVGLGFDG
DADRIGVVDDQGNIVWGDILMILFWREILPKHPGAKAIVEIKSSQALVDEIERLGGEVVW
WKSGHSLIKAKMKELNALFSGEVSGHMFFADEYYGFDDSFYAAGRLLRILSNSDKSLSEM
LSDVPKYYSTAETRIPCSDEEKFQVIEKIKESALKDYDAITIDGVRILYPRGWGLVRASN
TQPVLVARAEGKTEKDLEEYCNDLKKRILEAGVDDFQWEY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaccagagcacatattcagggaatacgacataaggggtttagccgacgaagaa
ttgaacagcgagaacgtccaagccatagcccttgcctttggcaccctcttaaaaaggaaa
ggaattgggcgaatatgcctgggaggagacgtcaggccttccaccgaaaggatcagaaag
gacgtaatagaaggaataacccttgcaggtatagacgttacggacgtgggagtggtaacg
acccccatgctctattggagcctttaccattacggtgtgaacggtggcataatgataact
ggcagtcacaaccctccagagttcaacggcctcaagcttgcagtgggcaagaccaccctt
tatggaagacagatcaaggaaatttacgacatgatctctaaaaacgaccttgagaaagga
accaaaaagggctctgtattctctgaatcaatcaacgaaccttacatcaacatgctcctt
tcaaaaataaccctagggcctaagaaactcaaggtcgtcacggactcaggaaacggtaca
gccggtcccatcataaacgaatatttgaaaagatcaggatgcgaagtcgttccactcttc
gcagaacctgacggccgattccctaaccaccaccccgacccaactaagagagagaacctc
ggaacccttatagacacagtgataaaggaaaaagctgacgtggggctaggcttcgacgga
gatgctgaccgtatcggagttgtggatgaccaagggaacatagtgtggggagatattcta
atgatcctcttctggcgggaaatacttcccaaacatccaggagcaaaagctatagtggaa
ataaaaagctcccaggcattggtggacgaaatagaacgattgggtggggaggtagtatgg
tggaaatcaggccactcgctcattaaggccaagatgaaggaactaaacgccctcttctcc
ggagaagtttcagggcacatgttctttgccgatgaatattatggctttgatgattccttt
tacgcagcgggaagactgctgaggatcctatccaactcggataaaagcctctcggaaatg
ctctcagacgtgccgaaatattacagcaccgctgaaactcgcatcccctgcagtgatgaa
gaaaagtttcaagttatcgaaaaaataaaggaaagcgccctcaaagattacgacgctata
actatagatggagtaagaatcctatatccaaggggttggggattggtaagggcttccaac
acccagccagttttggtcgccagagcggaaggaaagacagaaaaagaccttgaggaatat
tgcaatgacctcaagaaacggatccttgaggctggcgtggatgacttccagtgggaatac
tga

DBGET integrated database retrieval system