KEGG   Thermovirga lienii: Tlie_1646Help
Entry
Tlie_1646         CDS       T01644                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tli  Thermovirga lienii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tlie_1646
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tlie_1646
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tlie_1646
Enzymes [BR:tli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tlie_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1709287..1710489
Genome map
AA seq 400 aa AA seqDB search
MEKLSAVHTNAAGKGFYGEFGGSYVPEELKPRLEELERAYENILSDQSFFEEFHRLLKEY
VGRPSAITECQNISKKFGGGRLFLKREDLNHTGAHKINNALGQALLAKRMGKNRVIAETG
AGMHGTATATVCALLGLQCTIYMGAVDVKRQAPNVARMKVLGAEVVPVTFGQQTLKEAVD
AALAEYVKDPDVFYLLGSAVGPHPYPAIVREFQSVIGEEARRQFMEREGKMPDYVVACVG
GGSNAIGLFSGFINDPSVKIVGVEPAGKGLDTGEHAATLVAGKPGIIHGFKSYVLTDEKG
EPAEVYSISAGLDYPGVGPEHAYLKESGRAQYVAVTDQQALEAFSELCRLEGIIPALESS
HALAYALELLPNLNADESVLVNLSGRGDKDLDTVLPILGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagctgagtgcagtacatactaacgcagcagggaaagggttctacggagaattc
gggggcagttacgttcccgaagaacttaagcctcgccttgaagagctagaaagggcatac
gagaacatcctgtccgatcaatcgtttttcgaggaatttcatagacttctcaaggagtac
gtaggaaggccgtcggccatcacggagtgccagaacatatcgaagaagttcggagggggc
agactgtttctcaagcgggaagaccttaatcacacaggggcccacaagataaacaacgcg
ttggggcaagcccttttggcaaaacgcatgggaaaaaacagggtaattgccgaaaccggc
gccgggatgcatggaactgccacggccactgtttgcgctcttttaggactgcagtgcacc
atttacatgggagcagtagacgtcaaaaggcaggccccaaacgtggcacgcatgaaggtt
ttaggggctgaggttgtgcccgttactttcggccagcaaacactcaaagaagccgttgac
gctgcccttgcagaatacgtcaaagatccagatgtgttctatcttttaggttccgcagta
ggcccccacccctaccctgcaatagttagggagttccaaagtgtcattggagaggaggca
agaagacagtttatggagagggaaggcaagatgccagactacgtagtggcatgcgtagga
ggggggagcaatgctataggtctgttttcaggcttcataaatgacccatcggtaaagata
gtgggagtagaaccagcaggtaagggactagacacaggcgaacacgctgccaccttggtc
gccggaaagccaggaataatccacggcttcaaaagctacgtcctaaccgacgaaaaaggt
gaaccggcagaagtatactccatttctgcaggcttagattatcctggagtaggtcctgag
cacgcgtatctcaaagaatcaggtagggcccaatatgttgcagtgaccgaccaacaggcc
ttggaagccttttccgagctatgtaggcttgaaggaataataccagccctagaaagctct
catgccctggcctatgcgttggaactccttcccaatttgaatgccgatgaatcggtgctc
gtgaatctctcaggtaggggggacaaagatctagacaccgtactacctattttgggatta
taa

DBGET integrated database retrieval system