KEGG   Thermovirga lienii: Tlie_1698Help
Entry
Tlie_1698         CDS       T01644                                 

Definition
D-cysteine desulfhydrase
Organism
tli  Thermovirga lienii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1764988..1766025
Genome map
AA seq 345 aa AA seqDB search
MQSVIPVQKVALANLPTKIHPLLRVSAWLGGPEIWIKRDDLTGCALSGNKVRKLEYLAYD
ATKKKSDVLITCGGIQSNHARATAAVAAQLGMKCHLVLSGHEEDLPDGNLFLDMLFGAQV
AFVEGADLSRLDHAMEEVAQKYKAKGLNPYIVPLGASNALGALGYVETAAEIAMQAGELN
VRFDHVVLPCGSAGTLAGLATGFSHLESKTQIWGISVSFEKQWIKDKVSELTQEIKKFFL
PQLNTPLENFHVLDSYIGEGYGKTTPQQLKMIHEIASMEGIVLDPVYTGKAFWGLKEEIQ
RGTFKKGHKVLFLHTGGIFGLFARHYKEMLTSDILRPENSQTNTP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctgtaattcctgtacaaaaggtggccttagcaaaccttcccactaagatccat
cccctcctgcgcgtctctgcttggcttggagggccagaaatatggataaaaagggatgac
ctgacggggtgtgccctctccggcaacaaagtaaggaaactggaatacctggcctacgac
gccaccaagaaaaaatcagacgtattaataacgtgtggaggcatccagtccaaccatgcc
agagccaccgccgccgttgcggcgcagctgggaatgaagtgccacctggtcctttctgga
catgaggaagatctacccgatggcaacctttttctggatatgctctttggagcgcaggtg
gcctttgttgagggtgctgacctttctcggctggaccatgcaatggaggaggttgctcaa
aaatataaggcaaaaggtctcaacccctacatagtccccttgggcgcctccaatgccctg
ggagctttgggctatgtcgaaacagcggcggaaatagcaatgcaagcaggagagctcaac
gtacgattcgatcacgtggttctcccctgcggatccgctggaactttggcggggctcgcc
acaggcttttctcatcttgagagcaaaacccaaatttggggcatcagcgtaagcttcgaa
aagcagtggattaaggataaggtttctgaactaactcaagagatcaaaaagttcttccta
cctcaactcaatacccctctggagaactttcacgtcctggacagctacataggggaaggt
tacgggaagaccacaccccagcagctaaagatgatccatgaaatagcctccatggagggc
attgtcttggaccctgtgtatacagggaaagccttctggggcttaaaagaggagattcaa
agagggaccttcaaaaaggggcataaagtcctattcctccacacgggtgggattttcggc
ctctttgcaaggcactacaaagagatgttaacaagtgacatattgaggcctgaaaattcg
caaactaatacaccttga

DBGET integrated database retrieval system