KEGG   Thermovirga lienii: Tlie_1698Help
Entry
Tlie_1698         CDS       T01644                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
tli  Thermovirga lienii
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Tlie_1698
Enzymes [BR:tli01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Tlie_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1764988..1766025
Genome map
AA seq 345 aa AA seqDB search
MQSVIPVQKVALANLPTKIHPLLRVSAWLGGPEIWIKRDDLTGCALSGNKVRKLEYLAYD
ATKKKSDVLITCGGIQSNHARATAAVAAQLGMKCHLVLSGHEEDLPDGNLFLDMLFGAQV
AFVEGADLSRLDHAMEEVAQKYKAKGLNPYIVPLGASNALGALGYVETAAEIAMQAGELN
VRFDHVVLPCGSAGTLAGLATGFSHLESKTQIWGISVSFEKQWIKDKVSELTQEIKKFFL
PQLNTPLENFHVLDSYIGEGYGKTTPQQLKMIHEIASMEGIVLDPVYTGKAFWGLKEEIQ
RGTFKKGHKVLFLHTGGIFGLFARHYKEMLTSDILRPENSQTNTP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctgtaattcctgtacaaaaggtggccttagcaaaccttcccactaagatccat
cccctcctgcgcgtctctgcttggcttggagggccagaaatatggataaaaagggatgac
ctgacggggtgtgccctctccggcaacaaagtaaggaaactggaatacctggcctacgac
gccaccaagaaaaaatcagacgtattaataacgtgtggaggcatccagtccaaccatgcc
agagccaccgccgccgttgcggcgcagctgggaatgaagtgccacctggtcctttctgga
catgaggaagatctacccgatggcaacctttttctggatatgctctttggagcgcaggtg
gcctttgttgagggtgctgacctttctcggctggaccatgcaatggaggaggttgctcaa
aaatataaggcaaaaggtctcaacccctacatagtccccttgggcgcctccaatgccctg
ggagctttgggctatgtcgaaacagcggcggaaatagcaatgcaagcaggagagctcaac
gtacgattcgatcacgtggttctcccctgcggatccgctggaactttggcggggctcgcc
acaggcttttctcatcttgagagcaaaacccaaatttggggcatcagcgtaagcttcgaa
aagcagtggattaaggataaggtttctgaactaactcaagagatcaaaaagttcttccta
cctcaactcaatacccctctggagaactttcacgtcctggacagctacataggggaaggt
tacgggaagaccacaccccagcagctaaagatgatccatgaaatagcctccatggagggc
attgtcttggaccctgtgtatacagggaaagccttctggggcttaaaagaggagattcaa
agagggaccttcaaaaaggggcataaagtcctattcctccacacgggtgggattttcggc
ctctttgcaaggcactacaaagagatgttaacaagtgacatattgaggcctgaaaattcg
caaactaatacaccttga

DBGET integrated database retrieval system