KEGG   Thermovirga lienii: Tlie_1734Help
Entry
Tlie_1734         CDS       T01644                                 

Definition
(GenBank) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tli  Thermovirga lienii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tlie_1734
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tlie_1734
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tlie_1734
Enzymes [BR:tli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tlie_1734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1806426..1807673)
Genome map
AA seq 415 aa AA seqDB search
MAKPQLLKCAICGKEYEPEENLYTCPDCGLDGTFHVLYDYEKAAKEITKEKLRENDDFSL
WRYKAVLPVEKDENIPPLAAGWTPLYSSQKLARTYGVKEVYVKDDGRNPTGSLKDRASAV
GVAKALDYGRDVIACASTGNAASSLSGFAAVSGLKSIIFVPESAPVAKITQLLVYGACVV
LVKGTYEKAFDLATEAIERWGWYNRNCAINPYLVEGKKTCAMEIAEQLNWDAPDFVFVSV
GDGCIISGLYKGFSDLVKLGLTERVPHIVGVQAEGASPIYKAFKEGAPRVEFSPASTVAD
SISVGAPRNWAKALNGVRSSGGDMLAVSDDEILSAIPELARTTGVFGEPAGVTAFAGFRK
AAREGKLPKDARVALVVTGNGLKDIDGARRAVGQPIVTEPCLLGLEKALKERNVI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaacctcaattgctaaaatgtgccatttgcggaaaagaatatgagccagaagag
aacctttatacgtgccctgactgcggcttggatgggacttttcacgtgctgtacgattac
gagaaggcggcaaaggagataacgaaagaaaagcttagagaaaacgatgatttttctctt
tggaggtacaaggctgttctgcccgtcgagaaagacgaaaacattcctcctcttgcggca
ggttggacacccctttacagctcccaaaagcttgccagaacttacggtgtaaaagaagtt
tacgtgaaagacgacggtcgcaaccctacgggctctctgaaggaccgtgccagcgctgtt
ggcgttgcaaaggctctggattacggaagggatgtcatagcttgcgcttctactggcaac
gcagcaagttccctttcaggatttgctgcagtctcaggtcttaaaagcattatcttcgtt
cccgaaagcgctccggtggccaaaatcacccagcttctggtgtacggtgcatgtgtggtt
ttggtaaaggggacatacgagaaagcttttgacctggccaccgaggcaatagagcgctgg
ggctggtataatcgtaattgtgcgataaacccttacctagttgaaggaaaaaagacctgt
gccatggagatagcggagcagctgaattgggatgcgccagattttgttttcgtatctgtc
ggagatggttgcataataagcgggttgtataaggggttttctgatttggtgaagcttggg
ttaacggagcgagtgcctcatatagtgggagttcaggcggagggcgcaagcccaatatac
aaggcattcaaagaaggggccccgagggtggaatttagcccggcatccaccgtcgcggac
agtatctccgttggggcaccgcgaaactgggccaaggctcttaacggtgttcgaagcagc
ggaggtgatatgctggcggtatcggatgatgagattctttcagccataccggaactggcc
aggacaacgggggtctttggggaacctgctggcgttactgcttttgcgggattccgaaag
gccgcgcgggaaggtaagcttcccaaggatgcaagggtcgcgttagtggtgacaggcaac
gggctcaaggacatagatggtgcccgcagggcagtggggcagcctatagttactgagcct
tgtcttttggggttagagaaggcattgaaagagagaaacgtaatataa

DBGET integrated database retrieval system