KEGG   Thermovirga lienii: Tlie_1840Help
Entry
Tlie_1840         CDS       T01644                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tli  Thermovirga lienii
Pathway
tli00260  Glycine, serine and threonine metabolism
tli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tli01100  Metabolic pathways
tli01110  Biosynthesis of secondary metabolites
tli01130  Biosynthesis of antibiotics
tli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tlie_1840
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tlie_1840
Enzymes [BR:tli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tlie_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AER67550
JGI: Tlie_1840
UniProt: G7V916
Position
complement(1917067..1918257)
Genome map
AA seq 396 aa AA seqDB search
MSDRRGYFGDFGGRYVPETLIPALDELEKMYQEVRRDSSFNEELKRLLKTYCGRPTPLYF
AERLSERLDRRVYLKREDLNHTGAHKINNALGQVLLAKRMGKKRIIAETGAGQHGVAVAT
ASAREGLECHVYMGAEDMERQALNVEKMRLLGAEVVPVTSGSQTLKDATNEAIRDWVTNV
KDTYYVIGSVVGPHPYPTIVRDFQRVIGEETKSQILEAEGRLPDVLIACVGGGSNSIGFF
HPFLEDEHVGMVGVEAAGAGLFTGRHACTLTAGKVGVLHGSKSYLLQDPYGQVQVAYSIS
AGLDYPGVGPEHSYLKEKGRVEYTSVTDHEALEAFELLSKLEGIIPALESSHALAEAIKR
APLLGEDALVVVCLSGRGDKDMSSVRPYLLKGGVSI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagaagagggtattttggagatttcggtggccggtatgtgcctgagaccttg
ataccagccctggatgagttggagaaaatgtaccaagaggtaaggcgcgacagttccttc
aatgaggagctaaaaaggctccttaaaacctactgcggcaggcccacacctctttatttt
gctgaacgcctctcggaaaggttggatcgaagggtatatctcaaacgggaggacttgaac
cacacgggggctcataagataaacaacgccttgggccaggtccttttggccaaacggatg
ggcaagaagcggataatagctgaaaccggagcgggccagcacggagttgcagtggccacg
gcctccgccagggagggccttgaatgccacgtttatatgggcgccgaggacatggagcgc
caggcgttgaacgtggagaaaatgaggcttttgggagcagaggtggtgccagtaacctca
ggcagccagacgctgaaggacgccaccaacgaggcgataagggattgggtaaccaacgtc
aaagacacgtattatgtcatagggtcggtagtagggcctcatccttatcccactatagta
agagatttccagagagtgataggcgaggagacaaagtctcagatattggaggccgaggga
aggcttcccgatgtactaatagcttgcgtaggtggaggaagcaactcaatagggttcttc
catccctttcttgaggacgagcacgttgggatggtaggtgtggaggctgcaggagcgggc
cttttcacagggcgtcacgcatgcactctcactgctggcaaggtgggagttctccatgga
agtaagtcttatttgcttcaggatccatatggacaggtgcaggtggcttactcgatttct
gcggggttggattatcccggtgtaggaccggaacacagttacctcaaagagaaagggcga
gtggagtacacttctgtcacggaccatgaggctcttgaggcctttgagcttctaagcaag
cttgaggggataatcccggctctggaaagctcccatgcattggctgaagccataaagagg
gcgccccttttgggggaggatgccttggttgtggtgtgcctttcgggaaggggagacaag
gatatgtcctcagtgaggccttatctgctgaaaggtggtgtttccatatga

DBGET integrated database retrieval system