KEGG   Thermovirga lienii: Tlie_1840Help
Entry
Tlie_1840         CDS       T01644                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tli  Thermovirga lienii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tlie_1840
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tlie_1840
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tlie_1840
Enzymes [BR:tli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tlie_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1917067..1918257)
Genome map
AA seq 396 aa AA seqDB search
MSDRRGYFGDFGGRYVPETLIPALDELEKMYQEVRRDSSFNEELKRLLKTYCGRPTPLYF
AERLSERLDRRVYLKREDLNHTGAHKINNALGQVLLAKRMGKKRIIAETGAGQHGVAVAT
ASAREGLECHVYMGAEDMERQALNVEKMRLLGAEVVPVTSGSQTLKDATNEAIRDWVTNV
KDTYYVIGSVVGPHPYPTIVRDFQRVIGEETKSQILEAEGRLPDVLIACVGGGSNSIGFF
HPFLEDEHVGMVGVEAAGAGLFTGRHACTLTAGKVGVLHGSKSYLLQDPYGQVQVAYSIS
AGLDYPGVGPEHSYLKEKGRVEYTSVTDHEALEAFELLSKLEGIIPALESSHALAEAIKR
APLLGEDALVVVCLSGRGDKDMSSVRPYLLKGGVSI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagaagagggtattttggagatttcggtggccggtatgtgcctgagaccttg
ataccagccctggatgagttggagaaaatgtaccaagaggtaaggcgcgacagttccttc
aatgaggagctaaaaaggctccttaaaacctactgcggcaggcccacacctctttatttt
gctgaacgcctctcggaaaggttggatcgaagggtatatctcaaacgggaggacttgaac
cacacgggggctcataagataaacaacgccttgggccaggtccttttggccaaacggatg
ggcaagaagcggataatagctgaaaccggagcgggccagcacggagttgcagtggccacg
gcctccgccagggagggccttgaatgccacgtttatatgggcgccgaggacatggagcgc
caggcgttgaacgtggagaaaatgaggcttttgggagcagaggtggtgccagtaacctca
ggcagccagacgctgaaggacgccaccaacgaggcgataagggattgggtaaccaacgtc
aaagacacgtattatgtcatagggtcggtagtagggcctcatccttatcccactatagta
agagatttccagagagtgataggcgaggagacaaagtctcagatattggaggccgaggga
aggcttcccgatgtactaatagcttgcgtaggtggaggaagcaactcaatagggttcttc
catccctttcttgaggacgagcacgttgggatggtaggtgtggaggctgcaggagcgggc
cttttcacagggcgtcacgcatgcactctcactgctggcaaggtgggagttctccatgga
agtaagtcttatttgcttcaggatccatatggacaggtgcaggtggcttactcgatttct
gcggggttggattatcccggtgtaggaccggaacacagttacctcaaagagaaagggcga
gtggagtacacttctgtcacggaccatgaggctcttgaggcctttgagcttctaagcaag
cttgaggggataatcccggctctggaaagctcccatgcattggctgaagccataaagagg
gcgccccttttgggggaggatgccttggttgtggtgtgcctttcgggaaggggagacaag
gatatgtcctcagtgaggccttatctgctgaaaggtggtgtttccatatga

DBGET integrated database retrieval system