KEGG   Thermovirga lienii: Tlie_1842Help
Entry
Tlie_1842         CDS       T01644                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tli  Thermovirga lienii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tli01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tli00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1918894..1919646)
Genome map
AA seq 250 aa AA seqDB search
MTLSRIVEAKKAEIKRMKAPRRSLKEAISSARGLAVIAEIKKASPSRGVIERTLTPEARF
QKYVEGGAVAVSVVTEGNFFGGSNETLRQLSAISPVPLLRKDFIIDPLQLYESLFLGADA
VLLIASLLEGKKLSMMVEKALELGLEVLLEVHTPDELKRAMDTPARIIGINNRNLKDFSI
DLRVTQRMMDLARKLENPLKRKMVSESGISSLEDALFLASCGVDALLVGTYLVEAQDPQD
RIREIVERTR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttcaagaatagtggaagccaaaaaggctgagattaagaggatgaaagctcct
cgccgttctttgaaagaagccatttcgtctgccagggggcttgcggtcatagcggagatc
aaaaaggcatctcccagcaggggagtcatagaaaggactttaacgcccgaagccaggttc
caaaagtacgtggagggaggggctgtggcggtatcggtggtaactgaagggaacttcttt
ggaggttctaacgagaccttgagacagctgagtgccatttctcccgttccccttctgcgg
aaggatttcataatagatccccttcaactttacgagagcttgtttttgggagctgatgcc
gtgcttcttatagcttcccttttagaggggaaaaagctttccatgatggtggaaaaggcg
ctggagctgggccttgaagttttgttggaggttcatacccccgatgaattgaaaagagcc
atggacactcctgcgagaataataggaatcaacaacagaaacctaaaggacttttccata
gatcttagggtgactcaaaggatgatggatttggcgcgaaagcttgagaatcccctgaag
cgaaaaatggtctcagaaagcgggatttcctccctggaagatgctctctttttggcaagc
tgcggcgtggatgcccttttggtggggacttatcttgtggaggcccaagacccccaggac
aggataagggaaatagtggaaaggacccgatag

DBGET integrated database retrieval system